KEGG   Fragaria vesca (woodland strawberry): 101296307Help
Entry
101296307         CDS       T02666                                 

Definition
protein disulfide isomerase-like 2-3-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:fve04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 437 aa AA seqDB search
MRMRESQFRALPILLVFFFVFNACDALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAP
WCGHCRALTPIWEKVATVLKGVATVAALDADAHKSLAQDYGIQGFPTIKVFVPGKPPVDY
QGARDVKPIAEFALSQIKALLKDRLSGKSTGGSSEKPEPNASVELNSKNFDELVVKSKEL
WIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVDCDAEQSLMSRFNVQGFPTILVFG
ADKDSPVPYEGARTASAIESFALERLETNVAPPEVTELTGPDVLEEKCGSAAICFVAFLP
DILDSKAEGRNKYLHQLLSVAEKFKRSPYSYVWAAAGKQQDLENLVGVGGYGYPALVALN
VKKGVYAPLKSAFELDQITEFVREAGRGGKGNLPLNGTPNIVKSEPWDGKDGEIVEEDEF
SLEELMGEDTNSKDELR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgagagagagtcaattccgagctctaccaatcttgttggtgttcttcttcgtc
ttcaatgcctgtgatgcactctacggtccatcatcaccagtgcttcagctgactccctcc
aacttcaagtccaaggttctggactcgaacagagttgttctggttgagttctttgcgccg
tggtgtgggcattgtagagctctgactcctatatgggagaaagtcgctactgtgttgaag
ggtgtggccaccgtagctgctcttgatgctgatgcgcataagtcccttgctcaggattat
gggattcaaggattcccaacaataaaggtgttcgtacctggaaagccaccagttgattat
cagggagcaagagatgtgaaacctattgcagaatttgctctctcacagattaaggcactg
ttgaaggaccggttaagtggaaaatcaacaggaggatcaagtgaaaaacctgagcctaat
gcttcagtagaactaaattccaagaactttgatgaactagttgttaaaagtaaagaactc
tggattgtggagttctttgcaccttggtgtgggcactgtaaaaaattggcacctgagtgg
aagaaggctgccaaaaacttgaaggggaaggtgaagttgggacacgtggactgtgatgca
gagcagtcacttatgagcaggttcaatgttcaaggattcccaacaatattagtatttgga
gctgacaaagatagcccagtaccgtatgagggtgcaaggactgcttcagccattgaatcg
tttgctctcgaacgactagaaacaaatgttgcacctcctgaagtgactgagctaactggc
cctgatgtcttggaagagaaatgtggttcagcagccatctgtttcgtcgcttttctacct
gatatcttggattcaaaggctgaagggaggaacaagtaccttcaccagttattatccgtt
gcagagaagttcaaaaggagtccatatagctatgtctgggcggcagctggtaagcaacaa
gaccttgagaatcttgtaggtgttggtggttacgggtatcctgcattggtggccttaaat
gtgaaaaaaggtgtttatgcccctcttaagagtgcgttcgagcttgatcagattaccgaa
tttgtgagagaagctgggcgtggtggaaagggaaacttgcctctgaacggcacccccaac
atagtgaagagcgaaccatgggatggtaaggatggagagatcgttgaagaggatgagttc
tcccttgaagaactgatgggggaagatactaatagcaaggatgaattgagataa

DBGET integrated database retrieval system