KEGG   Fragaria vesca (woodland strawberry): 101296668Help
Entry
101296668         CDS       T02666                                 

Definition
histone deacetylase 9-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101296668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 430 aa AA seqDB search
MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL
AQFHSADYVEFLHRITPDKQHLFSNELARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
NNKLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKFGDLFFPGTGDVKEIGEREGKFYAINVPLKNGIDDTSFTRLFKT
IISKVIETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY
TKENVARCWTVETGVLLDSDLPNEIPENEYIKYFSPEFSLRIPNGHIENLNSKSYLSTIK
MQVLENLRCIQHAPSVQLHEVPPDFYIPDFDEDEQNPDERVHQHTQDKHIQRDDEYYEGD
NDNDHNMEDT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaaaagacagaatctcttacttctatgatggggatgtgggcagcgtctacttc
gggcccaaccatccaatgaagccacaccggctgtgtatgacccatcaccttgtgctctct
tatgatctccacaagaagatggaaatttatcggccccacaaggcgtacccggtggagctt
gcgcagttccattcggccgactatgttgagtttctccaccggattacaccggacaagcag
catttgttctccaatgaattagcaagatataatcttggagaagattgccctgtattcgac
aacttgtttgaattctgtcagatttatgccggcggcacgatagatgctgcacgtaggttg
aacaataagctctgtgacattgctataaattgggctggtggattacaccatgccaaaaag
tgtggcgcatctggattttgttacatcaatgatttggtcttgggtatcttggagcttcta
aaacatcatgctcgggtattatacattgacatagatgtgcatcatggcgatggggtagag
gaagctttttactttactgatagggtaatgactgttagtttccacaagtttggggaccta
ttttttccaggaaccggtgatgttaaggaaataggagaaagggaaggcaagttttatgcc
attaatgtcccactaaagaatggaatagatgatacaagcttcaccagacttttcaagact
attatttccaaggttattgaaacatatcaaccaggtgcaatagttctccaatgtggggca
gattcgcttgctggagaccgcttgggctgcttcaatctctccattgatggtcatgctgaa
tgtgttaggtttgtgaagaagttcaatatacccttactggtcacaggaggtggtggatac
acaaaagagaatgtggctcggtgttggactgttgagactggagttctactggattcagat
cttcccaatgagatcccagaaaacgagtatattaagtatttttcaccagagttctcgttg
aggattccaaatggccatatagagaacctaaatagtaaatcatatcttagcacaattaaa
atgcaagtcttggaaaatcttcgttgcatccaacatgctcctagtgtacaattgcacgag
gttccaccagatttttatattccagattttgatgaagatgagcagaaccctgatgaacgt
gtgcatcagcatacccaagacaagcacattcagcgtgatgacgaatattatgagggggac
aatgataacgatcacaacatggaagacacataa

DBGET integrated database retrieval system