KEGG   Fragaria vesca (woodland strawberry): 101296668Help
Entry
101296668         CDS       T02666                                 

Definition
(RefSeq) histone deacetylase 9
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101296668
Chromosome [BR:fve03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101296668
   HDAC complexes
    Sin3A-HDAC complex
     101296668
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101296668
  Chromatin remodeling factors
   NuRD complex
    101296668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG5
AA seq 430 aa AA seqDB search
MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL
AQFHSADYVEFLHRITPDKQHLFSNELARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
NNKLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKFGDLFFPGTGDVKEIGEREGKFYAINVPLKNGIDDTSFTRLFKT
IISKVIETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY
TKENVARCWTVETGVLLDSDLPNEIPENEYIKYFSPEFSLRIPNGHIENLNSKSYLSTIK
MQVLENLRCIQHAPSVQLHEVPPDFYIPDFDEDEQNPDERVHQHTQDKHIQRDDEYYEGD
NDNDHNMEDT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaaaagacagaatctcttacttctatgatggggatgtgggcagcgtctacttc
gggcccaaccatccaatgaagccacaccggctgtgtatgacccatcaccttgtgctctct
tatgatctccacaagaagatggaaatttatcggccccacaaggcgtacccggtggagctt
gcgcagttccattcggccgactatgttgagtttctccaccggattacaccggacaagcag
catttgttctccaatgaattagcaagatataatcttggagaagattgccctgtattcgac
aacttgtttgaattctgtcagatttatgccggcggcacgatagatgctgcacgtaggttg
aacaataagctctgtgacattgctataaattgggctggtggattacaccatgccaaaaag
tgtggcgcatctggattttgttacatcaatgatttggtcttgggtatcttggagcttcta
aaacatcatgctcgggtattatacattgacatagatgtgcatcatggcgatggggtagag
gaagctttttactttactgatagggtaatgactgttagtttccacaagtttggggaccta
ttttttccaggaaccggtgatgttaaggaaataggagaaagggaaggcaagttttatgcc
attaatgtcccactaaagaatggaatagatgatacaagcttcaccagacttttcaagact
attatttccaaggttattgaaacatatcaaccaggtgcaatagttctccaatgtggggca
gattcgcttgctggagaccgcttgggctgcttcaatctctccattgatggtcatgctgaa
tgtgttaggtttgtgaagaagttcaatatacccttactggtcacaggaggtggtggatac
acaaaagagaatgtggctcggtgttggactgttgagactggagttctactggattcagat
cttcccaatgagatcccagaaaacgagtatattaagtatttttcaccagagttctcgttg
aggattccaaatggccatatagagaacctaaatagtaaatcatatcttagcacaattaaa
atgcaagtcttggaaaatcttcgttgcatccaacatgctcctagtgtacaattgcacgag
gttccaccagatttttatattccagattttgatgaagatgagcagaaccctgatgaacgt
gtgcatcagcatacccaagacaagcacattcagcgtgatgacgaatattatgagggggac
aatgataacgatcacaacatggaagacacataa

DBGET integrated database retrieval system