KEGG   Fragaria vesca (woodland strawberry): 101297368Help
Entry
101297368         CDS       T02666                                 

Definition
mitogen-activated protein kinase homolog MMK1-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Plant hormone signal transduction
Class
Environmental Information Processing; Signal transduction; Plant hormone signal transduction [PATH:fve04075]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 391 aa AA seqDB search
MEVGGQSGDTVMSEAGPTQQQQQAVAQPEAIPATLSHGGRFIQYNIFGNVFEVTAKYKPP
IMPIGKGAYGIVCSALNSETSEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAI
RDIIPPPQRNVFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANV
LHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAI
DIWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSDAELGFLNENAKRYIKQLPLY
HRQSFTEKFPQVHPSAIDLVEKMLTFNPSKRITVEDALAHPYLTSLHDISDEPVCMTPFS
FDFEQHALSEEQMKELIYREALAFNPEYQQH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcggaggtcaatcaggagacacggtgatgtcagaggctggccccacccagcag
cagcagcaggcagtagctcaaccggaggccattccggcgacgctgagccacggcggcaga
ttcatccagtacaacatcttcggcaacgttttcgaggtcacggccaagtacaagcccccc
atcatgcccatcggcaaaggcgcttacggcatcgtctgctcggctttgaattcggagacg
agcgagcacgtggccattaagaagattgcgaatgctttcgacaacaagatcgatgcaaag
aggactctgagggagatcaagctgctccgacatatggatcatgaaaacgttgttgccatt
cgggacattatccccccaccgcagaggaatgtctttaacgatgtttacattgcttatgag
ctcatggacactgatctccatcagatcattcgatccaatcaagctctatctgaggagcat
tgtcagtatttcttataccagatcctccgtggattgaaatacattcattccgcaaatgtt
ctgcacagggacttaaagcctagcaatcttctcctaaatgctaactgtgacttaaaaata
tgcgattttggactagctcgagtcacctccgagactgattttatgacggagtacgttgtt
acacgatggtaccgagccccagaactattattaaactcttccgattacactgcagctatt
gatatatggtcagtcggttgtattttcatggaattgatggatcgaaagccattgtttcct
ggcagagatcatgtgcatcagctacgtctgctcatggagctgattggcaccccatcagat
gctgaactgggatttttaaatgaaaatgctaagagatacattaagcaacttcctctctac
caccggcagtcatttactgagaagtttcctcaagttcatccatcagctattgatcttgtt
gaaaagatgttgacatttaatccttcaaagagaattactgttgaagatgcactagctcat
ccctacttgacatctctccacgacatcagtgatgaacctgtttgcatgactcccttcagc
ttcgactttgagcagcatgcactgtctgaggaacaaatgaaagaattaatttatcgagag
gctcttgcatttaaccctgagtatcagcagcattga

DBGET integrated database retrieval system