KEGG   Fragaria vesca (woodland strawberry): 101298145Help
Entry
101298145         CDS       T02666                                 

Definition
endoglucanase 16-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101298145
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101298145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 479 aa AA seqDB search
MYVGKPSAIVVVWLALFQGLHAHLDYKDALTKSIIFLEAQRSGKLPPNHRPKWRGDSALD
DGKLANVDLAGGYYDAGDNVKYGLPMAFTVTTLAWAAIQYQSELKATGELQNVIDGIKWG
TDYFLKASRKKTLYVQVGDPNADHQCWVRPEDMKTPRTVLKIDENTPGSEIAGETSAAMA
AASIVFRPFDRAYARRLLNKAKLLFQMAKLHKGTYDGECPFYCSFSGYNDELFWAATWLY
KATKRPEYLTYIHEEAITATVAEFSWDLKYAGAQILVSKMFFEGDKTLENFKNQADSFIC
SNIPESPYAQVKTTPGGMIHLRDGANTQYVTGAALLFSIYSDFLAEHNQKVECSNKQFDS
THLMAFAKKQIDLLLGDNPNGRSYMVGFGQNAPTQAHHRGASIPVGTDSSNVNCPMSFVY
WYNKDVPNPNELTGAILGGPDINDQFHDKRWESVFTEPCTYVNSQAVGVLAKLATKSIA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtaggcaaaccctcggcgatcgttgttgtatggctcgcactctttcaaggactc
catgctcatttggactataaggatgccctaaccaagtccatcatcttccttgaggcacaa
agatccgggaagctccctcctaatcacagaccaaaatggagaggagactccgctctcgat
gatggcaaactagcaaatgtggaccttgcagggggatattatgatgccggcgacaatgtc
aagtacggacttccgatggctttcacagtcacaaccctggcgtgggcagccatccaatac
caatcggagctaaaggctacaggagaattgcagaatgtcatcgacggtattaaatgggga
acggattactttctcaaggctagtagaaaaaaaacattgtacgttcaagtaggagacccc
aatgcagaccatcagtgttgggttcgaccagaagacatgaagacaccaagaactgtgttg
aagatcgatgagaacactcccggatcagaaattgcaggtgaaacctcggcggcaatggct
gctgcttccatcgtgttcagaccctttgatcgtgcctatgctcgtcgactccttaacaaa
gcaaagctgctcttccaaatggctaaactacataaaggaacttacgacggagagtgccct
ttctactgctccttctccggctacaatgacgagctattttgggcagctacatggttgtat
aaggccaccaaaagaccagagtacttaacttacatacacgaagaagccattaccgctact
gtggccgagtttagctgggatcttaagtatgctggagctcaaatccttgtctccaagatg
ttctttgagggcgataagaccctagagaacttcaagaaccaagcagacagtttcatttgc
tccaacatcccggaaagtccatacgcccaagtcaaaaccactccgggaggtatgatccac
ctccgagacggcgccaacacacagtacgtcaccggggccgccctcttgttcagcatctac
agtgatttcctagccgaacacaaccaaaaggtagaatgctccaacaagcagttcgatagc
acccacctcatggccttcgctaagaaacagatcgacctcttgctaggagacaaccctaac
ggcagatcctacatggttggcttcggccaaaacgccccgacgcaggcgcaccaccgcggc
gcgtcgattccggtggggactgattccagcaatgtcaactgccccatgagctttgtgtac
tggtataacaaggatgttccaaaccctaacgagctgaccggagctatcttgggagggcct
gatattaacgatcagttccatgacaagcgctgggagtctgtgtttacagagccatgcacc
tacgtcaattcacaggcggttggggtgttggcaaagctagcaaccaagtctatcgcgtga

DBGET integrated database retrieval system