KEGG   Fragaria vesca (woodland strawberry): 101298322Help
Entry
101298322         CDS       T02666                                 

Definition
catalase-like
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Peroxisome
Module
Photorespiration
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101298322
  Amino acid metabolism
   00380 Tryptophan metabolism
    101298322
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101298322
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     101298322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 492 aa AA seqDB search
MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP
ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
ESLHMFTFLFDDLGIPQDYRHMEGSGVNTYTLISKTGKAYYVKFHWKPTCGVKCLLDEEA
IKVGGSNHSHATQDLYDSIAAGNYPEWKLYIQTIDPDHEDKFDFDPLDVTKTWPEDILPL
QPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNY
LQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPIPSAVYTGRREKS
IIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWISYWSQADKSLGQ
KLASHLNVRPNF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatccttacaagtaccgcccttcaagtgcttacgattccccgttttggaccaccaac
tccggtgctcccgtgtggaacaacaactcttctctaaccattggagctagaggtccaatt
ctcctcgaggactatcatttggttgagaaacttgccaattttgatagggagcgaatccca
gaacgtgttgtccatgctaggggagccagtgcaaagggattttttgaggtcacccatgat
atttctcatcttacatgtgctgacttccttcgagcccctggagtgcagacacctgtcatt
gtgcgtttctcaactgttatccatgagcgtggcagccctgaaaccctgagggatcctcgt
ggtttcgcagtgaagttttacaccagagagggaaattttgacttggtgggaaacaatttt
cctgtcttcttcgtccgtgatggaatgaaattcccagacatggtccatgctctcaagcct
aatccaaagtctcacatccaagagaattggaggatccttgacttcttttcccaccatcca
gaaagtctgcacatgttcaccttcctatttgatgacctgggaattccacaagattacagg
catatggaaggttctggtgttaatacatacactcttatcagtaagactgggaaggcatac
tacgtgaaatttcactggaagcccacatgtggagtcaagtgtttattggatgaagaggct
attaaggttggaggatctaatcatagccatgctacccaagatctctatgactcaattgct
gctgggaactaccctgagtggaaactttacattcagacaattgatcctgaccatgaggac
aaatttgactttgatccgcttgatgtgaccaagacttggcctgaggatattctccccctg
cagccagttggccgtttggttctgaataggaacatcgacaacttctttgcagagaatgaa
caacttgcattctgccctgcccttattgtccctggtgtctattattcagatgataagttg
ctccaaactcggatcttctcatatgccgatactcagaggcaccgtcttggcccaaactat
ctgcagctcccagttaatgctcccaagtctgctcaccacaacaatcaccatgagggattg
atgaatttcatgcacagggatgaagaggttaattacttcccttcaaggtttgaccctgtt
cgtcatgctgagagccaccccattccttctgctgtctacaccggaagacgtgagaagagc
atcattgagaaggagaacaacttcaagcaagctggagaaagatacagatcttttgcacca
gacaggcaagaacggtatatccgcaggtgggtagacgccctatccgacccacgttgcacc
catgagattcgcagcatttggatctcatattggtctcaggccgacaaatctttgggtcag
aaactcgcatctcatctcaatgttagaccaaacttttga

DBGET integrated database retrieval system