KEGG   Fragaria vesca (woodland strawberry): 101298322Help
Entry
101298322         CDS       T02666                                 

Definition
catalase-like
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Peroxisome
Module
Photorespiration
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fve00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:fve00380]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:fve04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 492 aa AA seqDB search
MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP
ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP
ESLHMFTFLFDDLGIPQDYRHMEGSGVNTYTLISKTGKAYYVKFHWKPTCGVKCLLDEEA
IKVGGSNHSHATQDLYDSIAAGNYPEWKLYIQTIDPDHEDKFDFDPLDVTKTWPEDILPL
QPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNY
LQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPIPSAVYTGRREKS
IIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWISYWSQADKSLGQ
KLASHLNVRPNF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatccttacaagtaccgcccttcaagtgcttacgattccccgttttggaccaccaac
tccggtgctcccgtgtggaacaacaactcttctctaaccattggagctagaggtccaatt
ctcctcgaggactatcatttggttgagaaacttgccaattttgatagggagcgaatccca
gaacgtgttgtccatgctaggggagccagtgcaaagggattttttgaggtcacccatgat
atttctcatcttacatgtgctgacttccttcgagcccctggagtgcagacacctgtcatt
gtgcgtttctcaactgttatccatgagcgtggcagccctgaaaccctgagggatcctcgt
ggtttcgcagtgaagttttacaccagagagggaaattttgacttggtgggaaacaatttt
cctgtcttcttcgtccgtgatggaatgaaattcccagacatggtccatgctctcaagcct
aatccaaagtctcacatccaagagaattggaggatccttgacttcttttcccaccatcca
gaaagtctgcacatgttcaccttcctatttgatgacctgggaattccacaagattacagg
catatggaaggttctggtgttaatacatacactcttatcagtaagactgggaaggcatac
tacgtgaaatttcactggaagcccacatgtggagtcaagtgtttattggatgaagaggct
attaaggttggaggatctaatcatagccatgctacccaagatctctatgactcaattgct
gctgggaactaccctgagtggaaactttacattcagacaattgatcctgaccatgaggac
aaatttgactttgatccgcttgatgtgaccaagacttggcctgaggatattctccccctg
cagccagttggccgtttggttctgaataggaacatcgacaacttctttgcagagaatgaa
caacttgcattctgccctgcccttattgtccctggtgtctattattcagatgataagttg
ctccaaactcggatcttctcatatgccgatactcagaggcaccgtcttggcccaaactat
ctgcagctcccagttaatgctcccaagtctgctcaccacaacaatcaccatgagggattg
atgaatttcatgcacagggatgaagaggttaattacttcccttcaaggtttgaccctgtt
cgtcatgctgagagccaccccattccttctgctgtctacaccggaagacgtgagaagagc
atcattgagaaggagaacaacttcaagcaagctggagaaagatacagatcttttgcacca
gacaggcaagaacggtatatccgcaggtgggtagacgccctatccgacccacgttgcacc
catgagattcgcagcatttggatctcatattggtctcaggccgacaaatctttgggtcag
aaactcgcatctcatctcaatgttagaccaaacttttga

DBGET integrated database retrieval system