KEGG   Fragaria vesca (woodland strawberry): 101298340Help
Entry
101298340         CDS       T02666                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101298340
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     101298340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 576 aa AA seqDB search
MFLKKNREGSTMAARPISLGPLLLQALAFLVLINAVAASSRPPSRNPHRTRQEPSYMKFV
SNATDFPLEDYYDYIIVGGGTAGCPLAATLSFRFRVLLLERGGVAYGNRNLMTQEGFLAS
LLDVNAFDSATEAFTSEDGVPNVRGRILGGSSAINAGFYSRADQEFYKRSTFNWDLKLVN
ESYDWVERAIVFRPELRNWQSAFRDGLLEAGVDPYNGYSFDHVVGTKTGGSTFDTLGRRH
SAADLLKYAKPLNIRVAVHATVERVLLASSTSSPVSRQSAVGVVFRDRSGRYHHAMLRKH
GEVLLSAGAIGTPQLLLLSGIGPRPYLASWGIPVAYHLPYVGQFMFDNPRNGISIVPPIP
LEHSLIQVVGITESGAYIESASTVIQFASPAHSGFLRTPAAPLYLTVATLMEKIVGPVSA
GSLRLASTDVKVNPIVRFNYFNSPVDVQRCVNGTRKIGEILRTRSMDDFKFQGWFGNKDF
RFIGPALPLDQFDFDEMADFCRRTVSTIWHYHGGCIAGKVVDRDFRVIGIDALRVVDGST
FGISPGTNPQATLLMLGRYVGQKIMNDRKGGYKMVD
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgaagaaaaacagagagggctcaacaatggcggcgagacccatttcgcttggt
ccacttcttctccaggcgcttgctttcttggtgctgatcaatgccgtcgccgcttcttca
cggccgccgtctcggaacccacaccgcactcgtcaagagccaagttacatgaagtttgtt
tccaacgccactgacttccctttggaggactactatgactacattatcgtgggaggtggc
actgctgggtgccctttggctgcgacgctgtcattcaggtttcgcgtcctcctgctcgag
agaggtggtgttgcttatggcaatcggaacttgatgacccaggaaggtttcttggcctca
ctcctggatgtcaacgcctttgactctgcgacagaagccttcacatctgaagatggcgtt
ccaaacgtccgaggacgcattcttggaggcagcagtgccataaatgctggtttctacagc
cgtgcagatcaggagttctacaaaagatccactttcaattgggatcttaaactggtgaat
gagtcctatgattgggtcgaaagagcaattgtcttcaggcctgagcttaggaattggcag
tcagcatttcgagatggcttattggaagctggtgttgatccctataatgggtatagtttt
gatcatgtggtggggaccaagactggtggttcaacatttgatactttgggaaggagacac
agtgctgccgacctccttaaatatgcaaagccattgaatattcgagttgcagtgcatgcc
actgtggaaagagttctattggcttcatctacttcatctccggtgtcgaggcaatctgcc
gttggggttgtttttcgtgacagaagtgggaggtatcaccatgctatgctaagaaaacac
ggagaggtgcttctctcagcaggtgcaattggaactccacagctacttctactgagtggt
attggcccaaggccttatcttgcatcttgggggattccagtggcttatcatcttccttat
gttgggcagtttatgtttgataatcccagaaatggcatctcaatagtgccaccaattcca
ctggaacactcactcatacaagtggttggcattactgaatcaggggcctacattgaatca
gcctccactgtaatccaatttgcatccccagcccactctggattccttaggacaccagct
gcgcctctatatcttactgtggccaccctcatggagaagattgttgggccagtctctgct
ggttctttaaggttggcttcaactgatgtcaaggtgaatcctattgttcgattcaattac
ttcaacagcccagtggatgtgcaaaggtgtgtgaatggaacgcgaaagattggtgagatt
ctcaggaccaggtctatggatgatttcaagttccagggatggtttgggaacaaggatttt
aggtttatagggcctgcattgccacttgatcagtttgactttgacgagatggcagatttc
tgccgccgcactgtaagcaccatatggcactaccatgggggctgcattgctgggaaggtg
gttgatcgtgatttccgggtcattggcatagatgcactccgtgttgttgatgggtctact
tttggtatatcaccagggacaaatccacaggctacccttctgatgctcggaagatatgtt
gggcagaagataatgaatgacagaaagggaggatataaaatggtagattga

DBGET integrated database retrieval system