KEGG   Fragaria vesca (woodland strawberry): 101298456Help
Entry
101298456         CDS       T02666                                 

Definition
chalcone synthase 2-like
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101298456
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    101298456
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     101298456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 389 aa AA seqDB search
MVTVEEVRKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMC
DKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQP
KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN
NRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELV
SAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFW
IAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRRSAANGHKT
TGEGKEWGVLFGFGPGLTVETVVLHSVAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgtcgaggaagtccgcaaggctcaacgtgccgagggtccggccaccgtcttg
gccatcgggactgcaactcctcccaactgtattgaccaaagcacgtaccccgactactac
ttccgtatcaccaacagcgagcacaaggctgagctcaaggagaaattccagcgcatgtgt
gacaaatctatgatcaagaagcgttacatgtatttgactgaagaaattctcaaagagaat
cctagcatgtgtgagtacatggcaccttcacttgatgcaagacaagacatggtggtggta
gaaattccaaagcttggaaaagaggccgctgtcaaggccattaaggaatggggtcagccc
aagtccaaaatcacacacttggtcttttgtaccactagtggtgtcgacatgcccggtgcc
gattaccagctcacgaagctcttgggcctccgcccgtccgtcaagcgtctcatgatgtac
cagcaaggctgtttcgccggaggcacggtgctccggttggcaaaagacttggctgagaac
aaccggggggcacgtgttctcgttgtttgctctgagatcactgccgtgaccttccgtggg
cctagcgacacccatctcgatagtcttgtgggccaagccttgttcggtgatggtgccgcg
gccattattgttgggtccgacccattgcccgaggttgagaggcctttgtttgagctggtc
tcagcggcccaaactatccttcccgatagtgacggggccatcgacgggcatcttcgtgaa
gttgggctcacatttcacctcctcaaagatgttcccgggctgatttcgaagaacatcgag
aagagcctcaacgaggccttcaagcctttgaacattaccgactggaactcacttttctgg
attgcacacccaggtggcccagcaattctggaccaggttgaggctaaattggccctcaag
cctgagaagttagaagccacgaggcatatcctatctgagtatggaaacatgtctagtgct
tgtgtgttgtttattttggacgaggtgaggaggaggtctgcagctaatgggcacaagacc
accggagaggggaaggagtggggtgttctgtttggattcgggcctgggctcaccgtcgag
accgttgtgcttcacagtgtggctgcttga

DBGET integrated database retrieval system