KEGG   Fragaria vesca (woodland strawberry): 101299152Help
Entry
101299152         CDS       T02666                                 

Definition
protein disulfide isomerase-like 5-2-like isoform 1
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101299152
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101299152
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101299152
  Exosomal proteins of colorectal cancer cells
   101299152
  Exosomal proteins of bladder cancer cells
   101299152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Unknown
AA seq 437 aa AA seqDB search
MRTGGFTVWFWALTSAVAVFGAVVSSSTTWVADGRVLELDDSNFESAISALDLVLVDFHA
PWCGHCKRLAPQLDAAAPMLASLKNPIVIAKVNADKYRSLGDKYGVDGFPTLKLFIHGVP
QEYKGPRKADLLVRYLKKFAAPDVTVLDSDSAIADFVEAAGTFFPVYIGFGLDESMISKL
ALKYKKKAWFSVAKDFSEDAMLLYDFDKAPALLSLHPSYNERHVFYGPFEEEFLEDFIKQ
SLLPLAIPINYDTLKSLEDDERKIVLTIVEDEDEEKSKNLIKILKSAASANRDLVFGYVG
IKQWEDFADTFGANKKTKLPKMVVWDRTEEYVTVNGSESIGEEDQASQVSQFLEGYKEGR
TIKERVGGSVSVTSFISSFLGLGTVYVLVFVVVTIILVRKATEEEPLRVGRGDEVDHATS
STAEAESREHKAGEKED
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgggcggcttcacggtgtggttctgggcgctgacgtcagcagttgctgtattt
ggggcggtagtttcgtcgtcgacgacttgggtggctgacgggagggtgctggagctggac
gactccaatttcgaatcggcgatttcagcgctggacttggtcttggtcgacttccacgcc
ccatggtgcggccactgcaagcgtctcgctcctcagttggatgcggcggcgccgatgctt
gcctcattgaagaacccaatagtgatagctaaggtgaatgctgacaagtataggtctcta
ggtgacaaatacggagtcgatggatttccgacactgaagctgttcatacatggtgtgccc
caagagtacaaaggccccaggaaagccgatttgcttgttcgttatttgaagaaatttgct
gctccggatgttactgtgcttgattcggactcggctattgctgattttgttgaggcagca
ggcacattcttccctgtatatattggctttgggttggatgagtccatgatatctaagtta
gcattgaagtacaaaaagaaggcctggttttcagttgcaaaggatttctctgaggatgca
atgctgttgtatgattttgacaaggctcctgctttgctatccctccatccaagttacaat
gagcggcacgttttttatggaccctttgaagaggaatttttggaggatttcataaaacaa
agtttgttacctttggccattcccatcaactatgacacgttaaaatcattggaggatgat
gaaaggaaaattgtgttgacaattgttgaggatgaggatgaagagaagtcaaagaacttg
attaagattttgaaatctgcggcatctgctaatcgagaccttgtatttggttatgtcggg
atcaaacaatgggaagattttgcagatacatttggagcgaacaagaagacaaaattacca
aaaatggttgtttgggatcgaacggaggagtacgtcacagttaatggctcagaaagcatt
ggtgaggaagatcaggcatctcaagtctcgcagtttcttgaaggatacaaggaaggaaga
acaattaaagaaagagttggtggcagtgtgtcggttacttcctttatatcttcatttctt
gggcttggaactgtgtatgtactagtttttgtggtagtgacaataattcttgttagaaaa
gccactgaggaagaacctctcagggttggtaggggagatgaagttgatcatgctacaagt
tctaccgctgaggctgaaagcagagagcataaagctggagaaaaggaagattag

DBGET integrated database retrieval system