KEGG   Fragaria vesca (woodland strawberry): 101299189Help
Entry
101299189         CDS       T02666                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101299189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 689 aa AA seqDB search
MSSSSDLVRKLESALGVSFGESVTDTAVLIATTSIALIIGVLVVLWRRSSDRSREFKQLA
VPKAVVVKEEEDEFEVASGKTRVSIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLD
DYAAEDDKYGEKLKKETMVFFMLATYGDGEPTDNAARFYKWFTEGTDRGVWLEQLRYGVF
GLGNRQYEHFNKIAKVVDDLLVEQGAKRLVTVGLGDDDQCIEDDFSAWKEALWPELDQLL
QDDTNTVSTPYTAVIPEYRVVIHDPSVTSFEDQNSNMANGNTSYDIHHPCRVNVAAQKEL
HKPESDRSCIHLEFDIHGTGITYETGDHVGVYADNCDDTVEEAAKLLGQPLDLLFSIHTD
NDDGTSLGSSLPPPFPGPCTLKTALACYADLLNPPKKAALNALAAHAVEPSEAERLKFLS
SPQGKDEYSKWVVGSQRSIVEVMAEFPSAKPPLGVFFAAVAPRLQPRYYSISSSPRFAPN
RVHVTSALVYGPTPTGRIHKGVCSFWMKNAVPLEKSQNCSQAPIFIRQSNFRLPSDHSVP
IVMVGPGTGLAPFRGFLQERLALKEEGAQLGPAVLFFGCRNRQMDFIYEDELNNFVEQGA
LSELIVAFSREGPSKEYVQHKMMEKAAYMWNLISQGGYFYVCGDAKGMARDVHRTLHTIV
QQEDKVDSTKAEAIVKKLQMDGRYLRDVW
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgagttcggatttggtgcggaagctggagtcggcgctcggggtttcgttcggg
gagtcggtgacggacacggcggtgctgatcgcgacgacttcaattgcgctgatcattgga
gttctggtggttctgtggcggagatcgtcggatcggagccgcgagtttaagcagctggcg
gtgcctaaggcggtggtggttaaggaggaggaagatgagtttgaggtcgcgtcggggaag
actagggttagtatattctatgggactcagaccggcacagctgaaggtttcgccaaggct
ttggcggaagagatcaaggcaagatatgagaaggctgctgtcaaggttattgacctggat
gattatgccgcggaggatgataaatatggagaaaaactgaagaaagagactatggtattt
tttatgttggccacttatggagatggagaaccgactgataatgcagcaagattttacaaa
tggtttactgagggaacagatcggggtgtctggctggaacaactaagatatggtgttttt
ggtctgggtaacaggcagtatgaacattttaataagatagcgaaagtggttgacgatttg
cttgttgaacaaggtgcaaagcgtcttgttaccgttggcttaggtgatgatgatcaatgc
attgaggatgacttttctgcttggaaggaagcactgtggcccgagctagatcaattactc
caggatgatacaaatactgtgtccaccccatatacagctgtgattcctgaatacagagtt
gttattcatgatcccagtgttacctcttttgaggatcagaactcgaatatggcaaatggg
aatacttcttatgacattcatcatccttgcagagttaatgttgctgctcagaaagagctc
cataagcctgagtctgatcgctcttgcatacatctggaatttgacatccatggaactggt
attacttacgaaactggagaccatgtgggtgtttatgcagataattgtgatgacacagtt
gaagaagctgcaaagttgttgggtcaacctttagatttgctgttctccattcacaccgac
aatgatgatggcacatcgcttggaagctcattgccgcctcctttccctggtccttgcaca
ctcaaaacagcattggcatgttatgctgacctgttgaacccacctaagaaggccgctctc
aatgctttggctgcacatgctgttgaacctagtgaggcagaaagactaaagttcttatca
tcacctcaggggaaggatgagtactcaaaatgggttgttggaagtcagagaagtattgta
gaggtaatggctgaattcccatcagcaaagcctccgctaggcgtgttttttgctgcagtt
gcccctcgcttgcagcctcgttactattcaatttcatcgtcaccaaggtttgccccgaat
cgtgttcatgtgacctctgctttggtttatggtcctactccgactggcagaatacacaaa
ggagtgtgttcattctggatgaagaatgcagtcccgctagagaaaagccagaactgtagc
caggctcctatttttattaggcaatctaatttcagattaccttctgaccattcagtccca
attgtcatggtggggcctggtacaggattagcacctttccgaggatttctacaggaaaga
ttagccctcaaagaggaaggtgctcaacttggtcctgcagttctcttctttggttgtaga
aaccgccaaatggatttcatatatgaagacgagttgaataattttgtggaacaaggtgca
ctatcagagttaattgttgcattctcacgggaaggaccatcaaaggagtatgttcaacat
aagatgatggagaaagcagcatacatgtggaacctaatatcacaagggggatacttctac
gtatgtggtgatgccaagggtatggcaagagatgttcatcggactttgcataccattgtc
caacaagaggataaggtagactcgacaaaggcagaggctatagtgaaaaagctccagatg
gatggccgatacctcagggatgtctggtga

DBGET integrated database retrieval system