KEGG   Fragaria vesca (woodland strawberry): 101300165Help
Entry
101300165         CDS       T02666                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like isoform 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101300165
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101300165
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101300165
Lipid biosynthesis proteins [BR:fve01004]
 Desaturase
  First
   101300165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 313 aa AA seqDB search
MLDSDHWLVEFWGREWNFVDMVTFTTFAFLHFLSLLAPFYFTWAAFSLAIALYFITGVAV
TLSFHRNLSHRSFKLPRWLEYFFAYCGVLSLQRSPLDWVSVHRSHHQFTDTVKDPHSPVR
GFWFSHIGWTLDYHGRNGNYGPRLSNVGDLKRQPYYIFLHYTYPLHNTGLGVLLYFIGGM
PFLVWGMGVRTVLFLHATFGINSICHTWGQQVWETGDLSRNNWLIGLLAHGEGWHNNHHA
FQHSARHGLEWWQIDVTWYVIRFLELVGLATDVKLPTETQKKQRALSNKMIHQGKQQQQL
ETNEVPKWQALKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattcggatcattggctggtggagttttgggggagggaatggaacttcgtggac
atggtcactttcactacctttgccttcttgcatttcctttctcttcttgcgccgttttac
ttcacctgggctgcgttttcgctggccattgctctctattttatcacaggtgtagccgta
accctttcgtttcataggaatctctcccacagaagcttcaagcttcccagatggcttgag
tacttctttgcctattgtggggttctatcacttcagagaagtccacttgattgggtgagc
gtacacagatcccaccatcagtttacagacacagtgaaagaccctcatagtccagttaga
ggattctggtttagtcatattggttggacactcgattaccatggtcgaaatggaaattat
ggaccacgactaagtaatgttggagatttgaaaagacaaccatactacatatttcttcat
tacacataccctcttcataatactggtctcggagttctattgtattttatcggaggaatg
ccgtttttggtttggggaatgggagtgaggacggtactctttctccatgcaacatttgga
ataaattcaatttgccatacatggggacaacaagtatgggaaactggtgatttatctaga
aacaattggttgattggattgctggcacacggagaaggttggcataacaatcaccatgct
ttccagcactcagcccgccacggcttggaatggtggcaaattgatgttacttggtatgtc
attagatttcttgaacttgtgggtttggcaacagatgtgaagcttccaactgagactcag
aagaaacaaagagctttaagcaacaagatgatccaccagggaaagcagcagcagcagctt
gaaacaaatgaagttccaaaatggcaagctttgaaagactaa

DBGET integrated database retrieval system