KEGG   Fragaria vesca (woodland strawberry): 101300898Help
Entry
101300898         CDS       T02666                                 

Definition
NADPH--cytochrome P450 reductase 2-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101300898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 709 aa AA seqDB search
MESTSGSSMKISPLDLMAAIFRGKMDPSNTSSAGAEVASVILENREFVMILTTSIAVLIG
CVVVFVWRRSSAQKPKLVQPLKPLVIPEPEPELDDGSKKVTIFFGTQTGTAEGFAKALAE
EAKARYDKVTFKVVDLDDYAADDEAYEEKLKNESLAIFFLATYGDGEPTDNAARFYKWFT
EGKEKEAWLQNLHYGVFGLGNRQYEHFNKVAVVVDEILAAQGGKRLVPVGLGDDDQCIED
DFTAWRELMWPELDQLLRDEDDATTPACTPYTAAVLEYRVVFNDTADASVEDKSWNNVNG
HAVIDAQHPCRANVAVRKELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYCENLSETV
EEAISLLGLAPEAHFSLYTEKDDGTPLSGGSLLPPFPPCTLRTALTRYADLLSSPKKSAL
LALAAYASDPAEADRLRHLASPAGKDEYAQWMVASQRSLLEVMAEFPSAKPPLGVFFAAV
APRLQPRYYSISSSPRMAPSRIHVTCALVCDKTPTGRIHKGICSTWMKNSVPWAKSDDCS
WAPIFVRQSNFRLPVDSKVPILMIGPGTGFAPFRGFLQERLALKEDGAELGPSILFFGCR
NSQMDYIYEDELNNFVEKGALSELVVAFSRQGPTKEYVQHKMMQKASDIWNMISQGGYIY
VCGDAKGMAKDVHRTLHTILQEQGSLDSSKAESMVKNLQTNGRYLRDVW
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgacttccggcagctcgatgaaaatctcgccgttggatctgatggcggcgatc
ttcaggggcaagatggacccctccaacacctcctccgccggcgccgaggttgcctccgtc
attctcgagaatcgggagttcgttatgatcctgacgacctcgattgccgtcttgatcggc
tgcgtcgtcgtttttgtgtggcggcggtctagtgctcaaaagcctaagcttgtccagccg
cttaagccgttggttattccggagcctgagccggagctcgacgatggaagcaagaaggtc
actatcttcttcggcacgcaaaccggtaccgctgaggggtttgccaaggctttggctgaa
gaggcgaaagctcgctacgataaggtcacattcaaagttgttgatttggacgattatgca
gctgatgatgaggcatatgaggagaaattgaaaaatgagagtttggcaattttcttcttg
gccacatatggtgatggtgagccaacggataatgctgctagattttacaagtggtttaca
gagggtaaagagaaggaagcatggcttcaaaatcttcattacggagtgtttggtcttgga
aacaggcagtatgagcatttcaataaggtggccgtggtggtggatgagatccttgctgcc
cagggtgggaagcgtcttgttccagtgggcctcggagatgacgatcaatgcatagaggat
gatttcactgcatggcgagaattgatgtggcctgagttggaccagttgcttcgagatgag
gatgatgcaaccacacctgcttgcacaccttacactgctgctgtcttggagtatcgagtt
gtatttaatgataccgctgatgcatcagtagaggataagagctggaataatgtaaatggt
catgctgtcattgatgctcagcacccatgcagggctaatgttgccgtgagaaaggaactt
catacccctgcatctgatcgttcttgcacccatctcgaatttgatattgctggcactgga
cttacatacgaaactggcgatcatgttggtgtgtactgtgagaatctttctgaaactgtg
gaagaggcaataagtttgttgggcctggctccggaagcacacttttcattgtacactgag
aaggatgatggtacaccactaagcggaggctccttgttgcctccctttccaccatgcaca
ttaagaacagcacttactcgatatgctgatcttttgagttctcctaagaagtctgcccta
ctggctttggctgcctatgcatctgatccagctgaagcggatcgattaagacatcttgca
tcacctgctgggaaggatgaatatgctcaatggatggttgcaagtcagagaagccttctt
gaggtcatggctgaatttccatcagccaagcccccacttggagtcttctttgcagcagtt
gctccgaggttgcagcctagatactactcaatctcttcatctccaaggatggcaccatct
aggattcatgtcacttgtgcactagtttgtgacaaaacaccaacaggaaggattcacaaa
ggaatatgttcaacctggatgaagaattctgtgccttgggccaaaagtgatgattgtagt
tgggcacccatttttgttcggcaatcaaacttcagacttcctgttgatagtaaagtacct
attctcatgattggtcctggaactggatttgctcctttcaggggtttcctgcaggaaaga
ttagctcttaaagaagatggagcagaacttggaccctccattttattctttggatgcaga
aatagtcaaatggactatatttatgaagatgagctgaacaactttgtagaaaaaggtgca
ctttctgagcttgtggttgcattctcccgccagggacccaccaaggaatatgtgcaacat
aaaatgatgcagaaggcttcggatatctggaacatgatatctcagggaggttatatatac
gtttgtggtgatgctaagggcatggccaaggatgtccaccggactcttcacacaatcttg
caggagcagggatctctggacagctcgaaagctgagagcatggtgaaaaatctgcaaacg
aatggcaggtatctgcgtgatgtgtggtaa

DBGET integrated database retrieval system