KEGG   Fragaria vesca (woodland strawberry): 101301175Help
Entry
101301175         CDS       T02666                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101301175
Peptidases [BR:fve01002]
 Cysteine Peptidases
  Family C86
   101301175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 183 aa AA seqDB search
MASESNTQIYHERQKLQFCLLHALNNLFQQKDAFTRPRLNEIAERLGVEEPNKEKWTPLS
VLFKPHHNALTGNYDINVLIAALEDKGKNVVWHDRRKGANTIDLDGDEDALMGILLNVPV
KRFAGLWKGRHWVTLRKIDGDWYDLDSDLVAPQAFEDSGRVRKFLDYIIGHGGEVLLVMN
DRQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagagcaatacccaaatctaccacgaacgccagaagcttcagttctgcctc
ttacacgcgctcaacaatctcttccagcagaaagatgcgtttactcgaccaagattgaat
gagattgctgaaagacttggggttgaagaacccaacaaggaaaagtggacacccttatct
gtgctctttaaaccccatcataatgcacttactggaaactatgacataaatgtgctaatt
gcggctttagaagataagggtaagaatgtggtttggcacgatcgtcgcaagggggctaat
acgattgatctagatggggatgaagatgctttgatgggtattttgcttaatgttccggtt
aagaggtttgcggggctatggaaaggtaggcattgggttacgttgaggaagattgatggg
gattggtacgatttggatagtgatcttgttgctcctcaggcttttgaagatagtgggaga
gttagaaagttcttggattacatcattgggcatggtggagaggttttgcttgttatgaat
gatagacagtga

DBGET integrated database retrieval system