KEGG   Fragaria vesca (woodland strawberry): 101301209Help
Entry
101301209         CDS       T02666                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101301209
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101301209
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101301209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 948 aa AA seqDB search
MGDKENGFAERDDQHSESSIDKVDPGKPAYLTWQRKVNSTGKAVVEFNLTLKEVIHMAPI
GIRLWRHQREETAKGREIMIDPFTKRARSSSHGVPLGGMGGGSIGRSLKGEFQRWQLLPK
TCEEDPVLADQFSVFVSRTNGEKYSSVLCPRNPDVKGNNASGIGSWDWNLKGDKSTYHAL
FPRAWSIYEGEPDPALKIVCRQISPIIPHNYKESSFPVSVFTFTLYNSGSTAANTTLLFT
WANSIGGLSEFSGQHVNSRAKVKDGVHSVLLHHKTATGKSPVTFAIAAEQTDGIHVSECP
CFVISGDSKGISAKDMWNEIKQHGSFDGLNSAETSLPSEQGSSIGAAVAASVTVPPDGVR
TVTFSLAWDSPEIIMGGKTYYRRYTKFFGTHGNAAANIAHDAILEHHNWESQIEAWQRPI
LEDKRLPEWYPVTLFNELYYLNSGGTIWTDGSPPVHSLVSIGGRKFSLDKSSLGVKNIID
APQQNDTAVDILGRMTTILEQIHMPVASNSAFGPNLLQEGEENIGQFLYLEGVEYHMWNT
YDVHFYSSFALVMLFPKLELSIQRDFAAAVMMHDPSKMSVLCDGKLVQRKVLGAVPHDIG
IHDPWFEVNAYNVYNTDRWKDLNPKFVLQIYRDVVATGDKKFAEAVWPSVYVAMAYMEQF
DRDGDGMIENEGFPDQTYDTWSVTGVSAYCGGLWLAALQAASALAREVGDKGSEDYFWCK
FQKAKVVYEKLWNGSYFNYDNSGQSASASIQADQLAGQWYTGACGLMPIVDQDKAQSALE
KVYNYNVLKVKNGKLGAVNGMLPDGTVDMTTLQSREIWSGVTYAVAATMIQEDMLDMAFH
TAGGVHAAAWSEEGLGYSFQTPEAWTTTGEFRSLAYMRPLAIWAMQWALSRPNKVLNRET
RAEVDQVSLLRDEAGFARVAQLLKLPPEEAASRSILQVVYDYTCKRMM
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaaggagaatgggtttgctgaaagagatgatcaacattctgagtcttcaatt
gacaaggttgacccggggaaacctgcatatctgacgtggcagcgaaaagtaaacagcacg
ggaaaggctgtcgtggagttcaatctaactttgaaagaagttattcatatggctccaatt
ggaattcgtctatggcgccatcaacgagaagaaacagctaaaggaagggagattatgatt
gatccatttactaagcgcgctcgatcatctagtcatggtgtaccacttggtggtatgggt
ggaggaagtatcggaagaagtttaaaaggtgaatttcagcgctggcagctactccccaaa
acatgtgaagaggatccagttttagcagatcaattttctgtatttgtttcccgcaccaat
ggtgaaaagtattctagtgtactctgtccaagaaacccagatgtcaaaggaaacaacgct
tcagggattggatcttgggactggaatttgaagggggataaatctacctatcatgccctt
ttcccaagggcttggtctatttatgagggtgaacctgacccagcacttaaaatagtctgt
cgtcaaatttcacccattattcctcataactacaaggagagcagcttccctgtctccgtt
tttactttcacgctgtataattcaggaagtactgctgcaaataccaccttgcttttcaca
tgggcaaattctattggagggctttctgaattttctggtcaacatgttaattcaagagca
aaggtgaaggatggcgtgcatagcgtgcttctacatcacaagactgcaactggaaaatcc
ccagtgacgtttgcaatagcagcagagcagactgatggcattcacgtgtcagagtgccct
tgctttgtgatatctggtgactccaagggcattagcgctaaagacatgtggaatgaaata
aaacagcatggatcgtttgacggtcttaattcagctgaaacatcattaccttcagaacaa
gggtcgtctattggggcagccgttgctgcatctgtgacagtaccaccagatggagtacgt
actgtaacattttcactggcatgggatagccctgaaataattatgggtggaaagacttat
tacaggcgttacactaaattctttggcacacatgggaatgcagctgcaaatattgctcat
gatgcaattcttgagcatcacaattgggaatcacaaatcgaggcatggcaaagaccgata
cttgaagataagaggcttcctgaatggtaccctgttactttgttcaatgagctatattat
cttaattctggcggcacaatttggacagatggatcacctcctgtgcatagtttagtaagt
attggaggaaggaagttttctcttgataaatcctcattaggtgtgaaaaacatcattgat
gcaccccagcaaaatgatactgctgttgacattcttggaaggatgactacaatacttgag
caaattcacatgcccgtggcatcaaattctgcatttggaccaaatctgcttcaggaggga
gaagaaaacattggtcaattcctttatcttgaaggagttgaatatcacatgtggaacact
tatgatgtccatttttactcatcttttgcactggtcatgctatttccaaaacttgaactc
agcatacaaagagacttcgcagcagcagtaatgatgcatgaccctagtaagatgagtgtt
ttatgtgatgggaagttggtccaaagaaaggttcttggagctgttccccatgatattggg
atccatgatccatggtttgaagtaaacgcttataatgtttataacacagatagatggaaa
gacttgaatcctaagtttgttctccaaatttatagggatgtggttgccactggtgataag
aagtttgcagaagctgtttggccttctgtttatgttgcaatggcttatatggaacaattt
gaccgggatggtgatggtatgattgagaatgaaggctttcctgatcaaacctatgataca
tggtctgtcactggtgtgagtgcatattgtggtgggttgtggttagcagctctgcaagct
gcttcagccttggcacgtgaagtaggtgacaagggttctgaggattatttttggtgcaag
tttcagaaggcaaaagtggtgtatgaaaaattatggaatggatcttacttcaactatgat
aacagtggtcaaagtgcaagtgcatcaattcaagcagatcaattggccggacaatggtat
accggagcatgtggacttatgccaatcgttgatcaagacaaggcacaaagtgcattggaa
aaggtttataattacaatgtcttaaaggtgaagaatgggaaattgggggctgttaacggg
atgcttcctgatggaactgttgacatgacaacattgcagtcgagagaaatatggtctggg
gtcacatatgctgttgctgcaacaatgatccaagaagatatgcttgacatggcatttcat
actgctggtggagtccatgcagctgcgtggtctgaagaaggtcttggatactcttttcag
actcctgaagcttggaccaccactggggaattcagatcattagcttacatgcgcccgctt
gccatatgggcaatgcaatgggcattatcaagacctaataaggttcttaaccgagagaca
agagcagaagttgatcaagtttctttgctccgggatgaggctggattcgcaagagttgct
cagcttttaaagttgccgccagaggaagcagcatccagaagcattttacaggttgtttat
gattatacttgcaagaggatgatgtga

DBGET integrated database retrieval system