KEGG   Fragaria vesca (woodland strawberry): 101301236Help
Entry
101301236         CDS       T02666                                 

Definition
beta-amylase 2, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101301236
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     101301236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 544 aa AA seqDB search
MALLSLQPFRCFTPRRPSNVSKTTMPALSFSPGLWGSPEFDSRRLRVVGGGKYRRLAVVS
AEGSVVENVGDEQVAEVAQIVQERDFTGTPYVPIYVMLPLGVINMNSEVVEPEVLMDQLR
ALKSVGVDGVMVDCWWGIVEAHNPQSYNWSGYKKLFQIVRDLNLKLQVVMSFHECGGNVG
DDVHIPLPYWVTEIGQKNPDIYFTNREGQRIVECLTWGIDKERVLKGRTAVEVYFDYMRS
FRVEFDEFFAEGIISEIEVGLGPCGELRYPSYPAQHGWKYPGIGEFQCYDRYLMENLRKA
AEVRGHSFWARAPDNAGSYNFRPQDTGFFRDGGDYDSYYGRFFLNWYSNVLVDHGDRVLT
LANLAFEGTSIAAKLSGIHWWYKTASHAAELTAGFYNPCNRDGYTPIAVMFKKHAAALNF
TCVELRTLNQHEDFPEAMADPEGLVWQVLNAAWDANIPVASENALNCHDREGYNKILENA
KPRNDPDGRHLSAFTYLRLSPVLLERHNFMEFERFVKKMHGEAATDLQINPNEENTADSS
ANLQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctctactctcacttcaacctttccgttgcttcactccacggagaccaagtaacgtt
tctaaaacgacaatgcctgcgttgtcgttctctccggggctttggggatcgccggagttt
gactcgaggaggttgagggtggtgggtggtgggaagtataggaggttggcggtggtgagt
gcggaggggagtgtggtggagaatgttggtgatgagcaggttgcagaggtggcacaaatt
gttcaggagcgtgatttcactgggactccttatgttcctatatatgtgatgttaccgttg
ggtgtcatcaatatgaacagtgaggtagttgagccagaagttctgatggatcaactgcga
gcgttgaagtcagttggtgttgacggtgttatggttgattgctggtgggggatagtcgag
gcgcataatccacagtcgtataattggagtggctacaagaagctcttccagattgtgcgt
gatctgaatcttaagttacaggttgtaatgtcatttcacgaatgcggaggcaatgttggg
gatgatgttcatatcccacttccttactgggtgacagaaattggtcaaaaaaatcctgat
atatattttaccaatagagaagggcaacggattgtggaatgcctcacgtggggaattgat
aaggagcgtgtcttaaaaggccggactgctgttgaggtttacttcgattacatgaggagc
ttcagggtcgaatttgatgaattttttgcggaaggaattatctcagagattgaagttggt
ttaggtccttgtggagagttacggtatccttcttatccagcacagcatggttggaaatat
cctggaattggtgaatttcagtgttatgatcggtacttaatggagaatctaaggaaggct
gcagaagtaagggggcactctttctgggccagagcacccgataatgcaggttcttacaat
tttcgaccacaagacacagggtttttccgcgatggaggtgattatgacagctactatggg
agattcttccttaattggtattccaatgttttggtggatcatggtgatcgtgtacttaca
ctggccaacttagcttttgaaggcacttcaattgctgcaaagctatcaggtattcattgg
tggtacaagactgccagccatgctgctgaattaactgctggattttacaatccctgcaat
cgtgatgggtatactccaattgcagtgatgtttaaaaagcatgcggctgccttgaatttc
acgtgtgttgaattgcgcacattaaaccagcacgaggacttcccagaagcaatggctgac
cctgagggtttagtttggcaggtgctgaatgctgcatgggatgccaacattccagttgct
agtgagaatgctcttaattgccatgatagagaaggctacaacaagatattggaaaatgcc
aaaccccggaatgatccagatggtaggcatttgtcggcatttacctacctcaggttaagc
ccggttctcctggagaggcataacttcatggagtttgaaagatttgtcaagaaaatgcat
ggagaagctgctacagatctccagattaatccaaatgaagagaacactgcagactcatct
gcaaatctgcagtag

DBGET integrated database retrieval system