KEGG   Fragaria vesca (woodland strawberry): 101301236Help
Entry
101301236         CDS       T02666                                 

Definition
(RefSeq) beta-amylase 2, chloroplastic
Organism
fve  Fragaria vesca (woodland strawberry)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG7
AA seq 544 aa AA seqDB search
MALLSLQPFRCFTPRRPSNVSKTTMPALSFSPGLWGSPEFDSRRLRVVGGGKYRRLAVVS
AEGSVVENVGDEQVAEVAQIVQERDFTGTPYVPIYVMLPLGVINMNSEVVEPEVLMDQLR
ALKSVGVDGVMVDCWWGIVEAHNPQSYNWSGYKKLFQIVRDLNLKLQVVMSFHECGGNVG
DDVHIPLPYWVTEIGQKNPDIYFTNREGQRIVECLTWGIDKERVLKGRTAVEVYFDYMRS
FRVEFDEFFAEGIISEIEVGLGPCGELRYPSYPAQHGWKYPGIGEFQCYDRYLMENLRKA
AEVRGHSFWARAPDNAGSYNFRPQDTGFFRDGGDYDSYYGRFFLNWYSNVLVDHGDRVLT
LANLAFEGTSIAAKLSGIHWWYKTASHAAELTAGFYNPCNRDGYTPIAVMFKKHAAALNF
TCVELRTLNQHEDFPEAMADPEGLVWQVLNAAWDANIPVASENALNCHDREGYNKILENA
KPRNDPDGRHLSAFTYLRLSPVLLERHNFMEFERFVKKMHGEAATDLQINPNEENTADSS
ANLQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctctactctcacttcaacctttccgttgcttcactccacggagaccaagtaacgtt
tctaaaacgacaatgcctgcgttgtcgttctctccggggctttggggatcgccggagttt
gactcgaggaggttgagggtggtgggtggtgggaagtataggaggttggcggtggtgagt
gcggaggggagtgtggtggagaatgttggtgatgagcaggttgcagaggtggcacaaatt
gttcaggagcgtgatttcactgggactccttatgttcctatatatgtgatgttaccgttg
ggtgtcatcaatatgaacagtgaggtagttgagccagaagttctgatggatcaactgcga
gcgttgaagtcagttggtgttgacggtgttatggttgattgctggtgggggatagtcgag
gcgcataatccacagtcgtataattggagtggctacaagaagctcttccagattgtgcgt
gatctgaatcttaagttacaggttgtaatgtcatttcacgaatgcggaggcaatgttggg
gatgatgttcatatcccacttccttactgggtgacagaaattggtcaaaaaaatcctgat
atatattttaccaatagagaagggcaacggattgtggaatgcctcacgtggggaattgat
aaggagcgtgtcttaaaaggccggactgctgttgaggtttacttcgattacatgaggagc
ttcagggtcgaatttgatgaattttttgcggaaggaattatctcagagattgaagttggt
ttaggtccttgtggagagttacggtatccttcttatccagcacagcatggttggaaatat
cctggaattggtgaatttcagtgttatgatcggtacttaatggagaatctaaggaaggct
gcagaagtaagggggcactctttctgggccagagcacccgataatgcaggttcttacaat
tttcgaccacaagacacagggtttttccgcgatggaggtgattatgacagctactatggg
agattcttccttaattggtattccaatgttttggtggatcatggtgatcgtgtacttaca
ctggccaacttagcttttgaaggcacttcaattgctgcaaagctatcaggtattcattgg
tggtacaagactgccagccatgctgctgaattaactgctggattttacaatccctgcaat
cgtgatgggtatactccaattgcagtgatgtttaaaaagcatgcggctgccttgaatttc
acgtgtgttgaattgcgcacattaaaccagcacgaggacttcccagaagcaatggctgac
cctgagggtttagtttggcaggtgctgaatgctgcatgggatgccaacattccagttgct
agtgagaatgctcttaattgccatgatagagaaggctacaacaagatattggaaaatgcc
aaaccccggaatgatccagatggtaggcatttgtcggcatttacctacctcaggttaagc
ccggttctcctggagaggcataacttcatggagtttgaaagatttgtcaagaaaatgcat
ggagaagctgctacagatctccagattaatccaaatgaagagaacactgcagactcatct
gcaaatctgcagtag

DBGET integrated database retrieval system