KEGG   Fragaria vesca (woodland strawberry): 101302205Help
Entry
101302205         CDS       T02666                                 

Definition
phosphoinositide phospholipase C 2-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:fve00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:fve04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 595 aa AA seqDB search
MSKQTYRVCFCFRRRFRLAVSEAPDDIKSLFDQYSENGLMSLDHLHRFLTEVQKEDLTKE
EAQTLLDQSLHEFRHLNIFHRKVLNLEAFFRFLFGDNNAPINTKVHHDMKAPLSHYYIHT
GHNSYLTGNQLSSDCSDVPIIEALHRGVRVIELDIWPNSTKDDVDVLHGGTLTAPVALLK
CFKSIKEHAFVASEYPVVITLEDHLTPNLQAKVAEMITQTFGEVLFSPPGSECLNEFPSP
ESLKRRVIISTKPPQEYLEAKAAAEKAAAAANDLKRGKSLAPDEEAWGREVPDQKGAVAE
DDKVNKLDEEDSPEEEYVEDVESKSPQNVAPEYKRLIAIHAGKPKGGLRECLKVDPNKVR
RLSLSEQQLEKASETHGKEIVRFTQRNILRVYPKGIRVDSSNYNPMIGWSHGAQMVAFNM
QGHGRSLWVMQGMFRANGGCGYVRKPDFLLNTTEIFDPKQKSSVKKTLKVKIYMGEGWYY
DFKHTHFDAYSPPDFYARVGIAGVAADTIMKKTKTLEDNWIPAWDEEFEFPLTCPELAVI
RIEVHEYDMSEKDDFGGQTSLPLSELKKGIRAVTLHDRKGEKYKSVKLLMHFDLV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcagacctacagagtgtgcttctgcttccgccgccgcttccgcctcgccgtg
tcggaagcgccggacgacatcaagtccctgttcgaccagtactccgagaatggcctcatg
agcctcgatcacctccaccgcttcctcaccgaagtccagaaggaggacctgaccaaggag
gaggcccagaccctactggatcagagcctccacgagttccgccacctcaatatcttccac
cgcaaggttctcaacctcgaggccttctttaggttcctcttcggcgacaacaacgcccct
atcaacaccaaggtacaccatgatatgaaagcgcctttgtcgcattattacatacacacc
ggacacaattcatacttgaccgggaatcagctgagcagcgactgcagtgatgtgccgatt
atagaagctcttcatagaggtgtgagggtgattgagcttgatatttggcctaattcgacc
aaagatgacgtggatgtgcttcatggagggaccttgactgctccagtggcacttctcaaa
tgcttcaaatctataaaggaacacgcttttgttgcatctgagtaccctgttgtaattacc
ttagaggatcatttaacccctaatcttcaagctaaagttgctgagatgatcactcaaaca
tttggagaggtgctgttttctcctccggggtccgagtgtcttaatgagtttccatcccca
gaatcactgaagagaagggttattatatcaactaaaccacctcaggaatatcttgaggct
aaagctgctgccgaaaaagctgctgcggctgcaaatgacttaaagaggggaaagagttta
gctcctgatgaggaagcttggggtagagaagtcccggaccaaaaaggagcagttgcagaa
gatgataaggtgaataaattggatgaagaagatagccctgaggaggaatatgttgaggat
gtagagtccaagtcaccacaaaatgtagcacctgaatataagcggttaattgccattcat
gctgggaagcctaaaggtggattgagggagtgtctcaaagtggatcccaataaagtgcgg
cgtcttagcttaagtgagcaacaacttgaaaaggcatcagaaactcatggaaaagagata
gtcagatttacccagaggaatattctgagggtgtacccaaagggtatacgtgtggactca
tcgaattacaacccaatgattgggtggtcacatggtgctcagatggttgcattcaatatg
cagggacatggaagatcactgtgggtgatgcaaggaatgtttagagctaatggtggatgt
ggatatgtgagaaaaccagattttctgttgaacactacagagatctttgatcctaaacag
aagtcatcagttaagaaaacattgaaggtgaaaatctatatgggagaagggtggtattat
gattttaagcacacgcactttgatgcgtattcacctcctgatttttatgcaagggtaggt
attgctggagttgctgcagatactataatgaagaaaacaaagactctagaggacaactgg
attcctgcttgggatgaagaattcgaattccctttaacttgtcctgaactggctgtgatt
cgcattgaagttcacgagtacgacatgtcagaaaaggatgactttggagggcaaacaagc
ctcccactgtctgagctgaaaaagggcattcgagcagttaccttacatgatcgtaaggga
gagaagtacaaatccgtaaagcttcttatgcacttcgatttagtttga

DBGET integrated database retrieval system