KEGG   Fragaria vesca (woodland strawberry): 101302510Help
Entry
101302510         CDS       T02666                                 

Definition
endoglucanase 24-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101302510
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101302510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 494 aa AA seqDB search
MKPMTHSLSFLLLLLPLATVHGGGHDYRDALSKCILFFEGQRSGVLPQDQRQSWRANSGL
SDGWTYNTDLTGGYYDAGDNVKFGFPMAFTTTMLAWSVIEFGEFMPPNELRNAMVAIRWG
TDYLLKTVSQQPNRIFVQVGDPITDHNCWERPEDMDTARTVYAIDSPNPASDVAGETAAA
LAASSMAFRSSDPGYADTLLRNAMKAFEFADTYRGAYSDNANVRDGVCPFYCDFDGYQDE
LLWSAAWLRRVTQDGGYLDYIQNNGKTLGAEDNINEFGWDNKHAGLNVLVSKEVLEGSMY
NLESYKSSADSFMCTLIPESSSSHIEYTPAGLIYKPGGSNLQHVTSISFLLLVYANYLAR
TSQSLNCGNIDVSPTALRAIAKKQVDYILGDNPMGLSYMVGYSDHYPQRIHHRGSSLPSI
KDHPQPIACKEGSVYFNSSNPNPNVLVGALVGGPGEDDVYDDDRADFRKSEPTTYINAPF
IGVLAYFVANPNPN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatgactcattccctctccttcctcctcctccttctccccctcgccaccgtc
cacggcggagggcacgactaccgagacgcattgtcgaaatgcatactcttcttcgagggc
cagaggtcgggggtcttgcctcaggaccaacgccagtcttggcgcgctaattccggcttg
agtgacggttggacttacaacactgacctcaccggcggttactacgacgccggagacaac
gttaagttcgggtttccgatggcgttcacaaccacaatgctggcgtggagtgtaatcgag
tttggggagttcatgcctcctaatgagctgaggaatgcgatggttgccattcgttggggg
acggattatctcctcaaaacggtgtcgcagcaacccaatcggatttttgtgcaagttggg
gatccaattacagaccacaattgctgggaaaggccggaagacatggacacagccaggact
gtatatgctattgactcgccaaatccggcttctgatgtcgccggtgagacagccgcggcg
cttgcagcttcttcaatggcgttccgatcctctgaccctggttacgcggacacattgttg
cgaaatgccatgaaagcctttgagtttgctgatacttacaggggagcttatagtgacaat
gccaatgttagagatggtgtctgcccattttactgtgatttcgatggttaccaagacgaa
ttgctatggagtgcagcctggctgaggagagtcactcaggatggtggttaccttgactac
atacaaaacaatggaaaaactcttggtgcagaggacaatataaacgaattcggttgggat
aacaagcatgctggcctcaatgttctagtctccaaggaagtcctagaaggcagcatgtac
aaccttgaatcctacaaatcatcggccgatagcttcatgtgcacgttaataccggagtca
tcatcctcccacatcgagtacactccagctggtctcatctacaagccaggaggcagcaat
ctgcaacatgtaacttccatttcattcctgctactcgtttacgcaaattaccttgcacga
acctcgcagtccctcaactgtgggaacatagatgtcagtccaacagcgcttcgcgcaatc
gccaaaaagcaggttgattacattttgggtgataatccaatggggttgtcatacatggtt
ggatacagcgaccattatccgcagcgaattcaccaccgtggctcttctttaccatcaatc
aaggaccatcctcaacccattgcttgcaaagaaggctcagtgtatttcaattcttcaaac
cctaaccctaatgtcctggtgggagccctagtaggaggacctggagaagatgatgtctat
gacgatgatcgcgctgattttaggaaatccgaaccaaccacatacattaatgcaccattt
attggtgttttggcatactttgtggctaatcccaatccaaactag

DBGET integrated database retrieval system