KEGG   Fragaria vesca (woodland strawberry): 101302673Help
Entry
101302673         CDS       T02666                                 

Definition
(RefSeq) histone acetyltransferase HAC1-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101302673
Transcription factors [BR:fve03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101302673
Chromosome [BR:fve03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101302673
Mitochondrial biogenesis [BR:fve03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101302673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG6
AA seq 1720 aa AA seqDB search
MNAQAHMSGQISGQVPNQAGSQLPVLPQHNGNVPSQMQNVGGPPRAMSSMDPELIRARQF
MQEKICHVIQQRPLPQLMNEKKFRDIVKRLEEGLLRSAVTKEDYMNLDTLESRLHNLIKR
PTQTNQSQQYPQLVNSSSPVGTMIPTPGMSHSGNSNMMANSSVDASMNTTGGTTSMSATP
VSTGNMLPGGGLHGSFSRADGSMSNGYQQSPGNFSIGSGGNMSSMGSQRIASQMIPTPGF
NNNTNQSYMNLESSNNSGGGFSTVDTSMLTQPQQQKQHIGGQNSRMLHNLGSQGTSGMRS
GLQQKSYGVSNGAINGGMGTIANNLPIVNETGISDSYLNSSAYANSSKPLQQHFDPHQRP
VMQGDGYGINNADSFGSGNYYGGAASVGSVMNPQNLNSVSMTPVSKTSSPLISNQSNMHS
QQQSVHVKPQQIDQLDKMSFQNSSRDGMLQSHQHQQFQQQPSQFQQQQQLAHHQRQQKQQ
NQQAQHLSSTDAFVQSPMISDLSSQAKRDNEVMHSQTDQFQMSEMQNQYHQQSAEDRLRN
AQHNSSGQHDLSSSLAQTSQQMQQMLHPHQLIAETRNDFSSLSVGAQSEPALQGQWRSQL
QDGSQRQVHMSQEHHVQEDFRQRLSRQDEAQCNNLSSEGPNIGQTVASRSTSNPEIHERF
RNQQKWLLFLRHARKCPSPEGKCKEFHCLAAQRLLKHIGRCHDEQCPIPQCPRTKKLVRH
HRSCLDSACPVCVPVKNYIQTHNKVPIQFPESGVQKSINGSSKAYDSVDTSARLMTKTLP
VVETSEDPQPSMKRLKIEQSSQPIVPDSVSNAVTVSANNEPHVSQDIQIQDFQHSEISMP
IKSEFTEVKMEAPLSSGQGNLDEMKDSFEENCNQRQDGVPAPYNEPAGLAKQGSVKLEKE
SHPAKEENAMQTAENPAGTKSGKPKIKGVSLTELFTPEQVRAHITGLRQWVGQSKAKAEK
NQAMEHAMSENSCQLCAVEKLTFEPPPMYCTPCGARIKRNSMYYTMGAGDTRHYFCIPCY
NEARGDTIVVDGTPIPKARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQA
EYTCPNCYIQEVERGERKPLPQSAVLGAKDLPRTILSDHIEQRLFKKLKVERQERARQQG
KSYDEVPGAESLVVRVVSSVDKKLEVKQRFLEIFQEDNYPTEFPYKSKVVLLFQKIEGVE
VCLFGMYVQEFGAECQFPNQRRVYLSYLDSVKYFRPEVKAVTGEALRTFVYHEILIGYLE
YCKLRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKASKESIVVEL
TNLYDHFFVSNGEGKAKVTAARLPYFDGDYWPGAAEDLIFQMRQDEDGRKQNKKGSTKKT
ITKRALKASGQTDLSGNASKDLLLMHKLGETISPMKEDFIMVHLQHACSHCCKLMVSGKR
WACNQCRYFQLCEKCYETEQKRDDRDRHPTNMRDKHDFRPYDITDVPVDTKDRDEILESE
FFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIEAGQG
WRCEVCPEYDVCNSCYQKDGGVDHHHKLTNHPSIADRDAQNKEARQMRVVQLRRMLDLLV
HASQCRSAQCMYPNCRKVKGLFRHGIQCKVRASGGCVLCKKMWYLLQLHARACKVSECHV
PRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEINNSG
NT seq 5163 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacaggcacatatgtcgggacaaatatctgggcaggtgcccaatcaggcaggt
tctcagttgcctgtgcttccccaacataacggaaatgttccttcccaaatgcaaaatgta
ggggggcctcctcgtgccatgtccagtatggaccccgagctcatcagagcacgtcaattt
atgcaagagaagatctgccatgttatacagcagcgaccacttccccagctgatgaatgaa
aagaagttcagggatattgtcaaacgcttggaggagggtttgttgagatcagctgtcacc
aaggaggattatatgaacttggacacgttagagagccgtttgcataatttgatcaagcgt
cctactcagaccaatcagagccaacagtatccacagcttgttaattcttcttctcctgtt
ggcacgatgataccgactcctggcatgtcacacagtgggaactcaaatatgatggctaat
tcttccgtggatgcttctatgaatacgactggtggaactactagcatgtcggccacacca
gtcagcacaggaaacatgttgccaggtggtggcttacatggttcgttcagtagagctgac
ggttctatgtctaacggatatcagcagtctcctggcaatttctccattggctctggagga
aacatgtcgtcaatgggttcacaaagaattgcaagccaaatgattcctactcctgggttt
aacaacaatacaaatcagtcttacatgaatttggaatcctctaataatagtggtggtggg
ttctctactgttgatacttcaatgctaacgcaaccacaacagcaaaaacagcatattggc
ggtcaaaatagtcgtatgcttcataaccttggcagccaagggacaagtggaatgaggtct
ggcttgcagcagaaatcatatggggtgtcaaatggggctataaatggtggaatgggaaca
atcgcaaacaatctaccaattgttaacgaaactggcatttcagatagctatctgaactcc
tcagcttatgccaattcttccaagcccttacagcaacactttgatccgcatcagcggcct
gtaatgcaaggtgatggctacggcataaacaatgctgattcttttgggtctggaaattac
tacggtggagcagcttctgttgggtcagtgatgaatcctcaaaatttgaattcagtcagc
atgacacctgtatccaagaccagctctccacttataagtaatcagtccaatatgcatagt
caacaacaaagtgtccacgtgaagcctcaacaaattgatcaattggataagatgagtttc
caaaattcttcaagagacggtatgcttcaatctcatcagcaccagcaatttcagcagcaa
cccagtcaatttcaacagcagcagcaattagctcaccatcaacgacaacagaagcagcaa
aatcagcaagcccagcatttgtcaagtactgatgcttttgttcagtctccaatgatatct
gacctaagcagtcaagcaaagcgtgataatgaagttatgcactcacaaacagatcagttc
caaatgtcagagatgcagaatcaataccatcagcagtctgctgaagatcgcttgaggaat
gctcagcataactcatctggtcagcatgatctctcctcgtcgttggcccaaacgtctcag
caaatgcagcaaatgttgcatcctcaccaattgattgcagagactcgaaatgatttcagt
tctctttctgttggagctcaatcagaaccagcacttcagggtcaatggcgttctcaattg
caagatgggagtcagaggcaggttcatatgtcacaagagcatcatgtccaagaagatttc
cgtcagagattatctaggcaagatgaagctcagtgtaataatctttcttcggaaggacct
aatattggccaaactgttgcttcgagaagcacatctaatcccgaaattcatgagcggttc
agaaatcaacagaaatggcttttgttcttgcgccatgctcgtaaatgtccatctcctgaa
gggaaatgtaaagaatttcattgtttagcagctcaaagattgttgaagcatattggaaga
tgccatgatgagcaatgccctattcctcaatgtcctcgcaccaaaaagctggttcgtcat
cacaggagttgcttggattcagcttgcccggtttgtgttcctgtcaagaattatattcag
acacataataaggtgccgatccaatttcctgaatctggtgtccagaaatcaataaatgga
tcttctaaagcctatgatagcgtcgacacttctgctagattgatgactaagacgcttcca
gttgttgagacttctgaagatccgcaaccatctatgaaacgcttgaagatagagcagtcc
tctcaacctattgttcctgattctgtaagtaatgcagtaacagtttctgcaaataatgaa
ccccatgtatcccaggatatacagattcaggatttccaacatagtgaaatttctatgcca
atcaaatctgagtttaccgaagtgaaaatggaagctcctttaagttccggacaagggaat
cttgatgagatgaaggatagttttgaggagaactgcaatcagaggcaggatggtgtgcct
gccccttataatgagcctgctggtttagctaagcaaggaagcgttaaacttgagaaagaa
tctcatccagctaaagaagaaaacgctatgcagactgcggaaaatccagctggaaccaag
tctgggaagcctaaaataaagggcgtgtcgttgactgaattgtttactccggagcaagtc
agggcccatattacgggtctcagacagtgggttggccagagcaaagcaaaggcagagaag
aaccaagcaatggagcatgcaatgagtgagaactcctgtcagttgtgtgcagtagagaag
cttacttttgaaccaccacccatgtattgcacaccttgtggtgctcgaataaagcgcaat
tctatgtattatacaatgggggccggtgacacacggcattatttctgtattccatgctat
aatgaggctcgtggagatacaatagttgttgatgggactcccattccaaaggcaaggcta
gagaagaagaaaaatgacgaggaaacagaagaatggtgggtccaatgtgacaaatgtgaa
gcttggcaacatcaaatctgtgctctgttcaatggccgaagaaatgacggtgggcaagct
gagtacacttgccctaattgctatatacaagaggttgaaaggggagagcgtaagccatta
ccacagagtgctgttttgggggccaaagacttaccgaggacaatactcagtgaccacata
gagcaacgcctatttaagaaactaaaggtggaaagacaagagagggcaagacagcagggg
aaaagttatgatgaggttcctggagcagaatcacttgttgttagagttgtttcatctgtc
gacaaaaaattggaagtgaagcagcggtttttagaaatattccaagaagacaattatcct
acagaattcccatataaatccaaggttgtactactgttccagaaaattgaaggtgtagaa
gtatgcttattcggcatgtatgttcaagaatttggagctgaatgtcaatttccaaatcag
cgccgtgtttatctatcgtatttggattccgttaagtatttcaggcctgaggttaaggcg
gttactggagaagctctccgtacatttgtttaccatgaaattctaattggatacctcgaa
tattgcaaactacgtgggtttacaagctgctacatttgggcatgtcctccattgaagggt
gaagattatattttatattgtcatccggaaatccagaaaacaccgaaatctgataagctt
cgtgaatggtatttggcaatgcttaggaaagcttctaaagaaagcattgtagttgagctc
actaatttatacgatcatttctttgtaagtaatggggaaggaaaggctaaggtcactgca
gctaggttgccctactttgatggtgactattggcccggtgctgcagaggatctcattttc
caaatgcgtcaagatgaggatgggagaaaacagaataaaaagggatcaaccaagaagact
ataacaaaaagggctctaaaagcatctgggcagactgatctctctggtaacgcgtcaaag
gacctgctcctaatgcacaaacttggtgaaactattagcccgatgaaggaagatttcatc
atggttcatttgcagcatgcatgctctcactgctgtaaactaatggtatctggaaaacgt
tgggcttgtaaccaatgcagatattttcagctgtgtgagaagtgttatgaaacagagcag
aaacgggatgatagagacagacaccctacgaatatgagggataaacatgatttccgtcca
tatgacatcactgatgtaccagtggatacgaaggacagagatgagattcttgagagtgaa
ttctttgacactagacaggcgtttctgagtctctgtcaagggaatcattatcagtatgat
actttacggagggctaaacattcctctatgatggtgctttaccatcttcataatccaact
gctcctgcatttgtgacaacatgcaatatatgtcatctcgacattgaagcaggtcaaggc
tggcgttgtgaagtttgccctgaatatgatgtttgcaatagttgttatcagaaggatggt
ggtgtggatcatcatcataaattgacaaatcatccatccattgctgaccgtgatgcacag
aataaggaagctaggcaaatgcgagttgtacagcttcggagaatgcttgatcttctagtg
catgcatcacaatgtcgttctgcacaatgtatgtatcccaattgtcgcaaggtcaaggga
cttttccgccatggaattcagtgtaaagttcgtgcatctggaggttgtgttctctgtaaa
aaaatgtggtacctcctgcaacttcatgctcgagcatgcaaagtatcggagtgccatgtg
cctcgttgcagagatctaaaagaacatttgaggaggctgcagcaacagtctgattcaagg
cgaagagctgctgtgatggagatgatgagacagagagctgctgagataaacaattctggg
taa

DBGET integrated database retrieval system