KEGG   Fragaria vesca (woodland strawberry): 101302788Help
Entry
101302788         CDS       T02666                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101302788
   00500 Starch and sucrose metabolism
    101302788
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101302788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG7
AA seq 644 aa AA seqDB search
MVDTSDSSYAPLPGEEPLFSGHSPTSLRRPWKGFAVILASVVFLLSLVALIIHQGPSNVV
PEKQDEHQHRPHSTTPASETTSSWEPRGKALGVSAKSNPPVSDELSYNWTNAMFSWQRTA
FHFQPEENWMNDPNGPLFHKGWYHLFYQYNPDSAVWGNITWGHAVSTDLIHWLYLPLAMV
ADQWYDANGVWSGSATLLPDGNIVMLYTGDTVDAVQVQCLAYPGNLSDPLLLDWVKYSGN
PVLTPPPGILSTDFRDPTTAWIGPDGKWRITIGSKINTTGVSFVYITEDFINYNMSQGLL
HEVPGTGMWECIDFYPVAINGSKGLDTSVNDPSVKHVLKASLDDTKVDHYALGTYFIENE
TWVPDNPALDVGIGLKYDYGRYYASKTFYDQNKERRILWGWINETDTESDDLAKGWASVQ
TIPRSVLFDNKTGTNLIQWPVEEIEELRLNSTDFSDVLVEAGAVVELDIGTATQLDIFVE
FEIESLGSETLNSSVGCGGGATDRTSFGPFGILVIADEILSELTPIYFNIANSTEGDVTT
YFCADERRSSKAPDVFKQVYGSEVPVLEGEKHFARVLVDHSIVESFAQGGRTVITSRIYP
TEAIYGAAKLFLFNNATGLNVKATLKIWQLNSAFIHPFPLDQVQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacactagtgattcttcctacgctcccttgccgggggaggagccattattttcc
ggtcattccccaacaagtctacggcgaccctggaagggattcgccgtgatcctcgcctcc
gtcgtgtttctcttgtcattggttgcattaatcatccaccaaggcccgtcaaatgtagtg
ccggaaaaacaagatgaacatcaacatcgtccacattcaactactccagcttcggaaact
acgtcgtcgtgggagccgagagggaaggcactaggagtctcggccaagtcgaacccgccg
gtctccgacgagctatcgtataactggaccaatgctatgttttcttggcagagaacagct
tttcactttcaaccagaagagaattggatgaatgatcctaatggtccattgtttcacaag
ggttggtatcacctgttctaccagtacaatccggactccgccgtatggggcaacatcacg
tggggccacgccgtctcgacggacctgatccactggctgtacctccccctcgcaatggtc
gccgatcagtggtacgacgcaaacggcgtgtggagcggctccgccacgctactccccgac
ggtaacattgtaatgttgtacactggtgacacggtcgatgcggtccaagtgcaatgccta
gcgtatccgggcaacttatctgatcccttactcttggattgggtcaagtactcgggtaac
ccggtgttgactcccccgcccgggattttatccacggatttccgtgaccccaccaccgcg
tggatcggacccgacggcaagtggcgcattaccattggctccaagatcaatacaactgga
gtttcgtttgtgtacatcacagaggatttcataaactacaatatgtcgcagggtctcctt
catgaggttccgggtacgggtatgtgggagtgcattgacttttacccggttgccataaac
gggtcgaagggtttggatacgtctgtgaatgacccgagtgtgaagcatgttctaaaggct
agcttggacgacacgaaagtggatcactatgcgcttgggacttatttcatagagaatgaa
acatgggtacccgataacccggctcttgatgtgggtattgggttgaagtatgactatgga
agatactatgcatcaaagacattttatgatcagaacaaggagagaaggatcctttggggt
tggatcaatgagaccgataccgagtccgatgacttggctaaaggttgggcatcagttcag
actattccgaggagtgtgttgtttgacaacaaaaccggcaccaatttgatccaatggcca
gtggaagagattgaggagttgagactgaacagcacagacttcagtgatgttttggttgaa
gcaggagcagttgttgaactagatattggaacagctacacagttggacatctttgtggag
tttgagatagagtcgttgggatcagagactttgaatagcagtgttggttgtggtgggggt
gctacagatagaaccagtttcggaccatttggtattctggtcattgcagatgagattctt
tcagagctgacccctatctatttcaacattgccaattcaactgaaggggatgtcacaact
tatttctgcgcagacgaaagaaggtcatctaaggctcctgatgtcttcaaacaagtttat
ggaagtgaagtgcctgtgttggagggcgaaaaacacttcgcgagagtattggttgatcat
tcgattgtagagagttttgcgcaaggaggtaggacagtgattacatctagaatttatcca
acagaagcaatctatggagcggcgaaactatttttgtttaacaatgcaacaggattgaat
gtcaaggccacactgaagatttggcagctgaactcagctttcattcaccctttcccatta
gaccaggtccaatga

DBGET integrated database retrieval system