KEGG   Fragaria vesca (woodland strawberry): 101304504Help
Entry
101304504         CDS       T02666                                 

Definition
NADH-cytochrome b5 reductase-like protein-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101304504
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101304504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 325 aa AA seqDB search
MAAFFQRLAKATPTAFTAAFNSGSGHSRSAFRFPIGALAAVSGGISYVYYHSSVYLDEIK
EEQTGPKVALNPNKWTEFKLQDSARVSHNTQLFRFTFDPTAKLGLDVASCLITRAPIGQD
AEGKPKFVTRPYTPISDPESKGYFDLLIKVYPEGKMSQHFASLKPGDVLEVKGPIEKLRY
IPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDTTKVSLLYANVSPDDILLKQKLDLLAA
AHPNLKVYYTVDNPTKSWKGGKGFISKDMAVKGLPGPSEDTLILVCGPPGMMEHISGGKA
KDWSQGELSGILKELGYTEEMVYKF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttctttcagagactcgccaaggccaccccaaccgccttcaccgccgccttc
aactccggctccggccactccaggtccgccttccgctttccgatcggtgctctcgcggct
gtctccggcggaatctcgtacgtctactaccactcgtcggtttatctagatgaaatcaaa
gaagaacagactggtccaaaagttgcacttaatccgaataaatggacagaatttaagctg
caagactcggcaagagttagccacaatactcaattgttcagatttacatttgacccaacc
gccaagttaggtttagatgtggcttcatgcctcattacaagggctccaattggacaagat
gctgaagggaaaccaaaatttgtcacacgcccgtatactcctatatcagatccagagtcc
aagggatactttgacttattgattaaggtgtatccagaagggaaaatgagccagcatttt
gcaagcttaaaaccaggcgatgtactcgaagtgaaggggcctattgaaaagttgagatat
attcccaacatgaagaaacacattggcatgattgcaggtggttctggtatcactccaatg
cttcaggtcattgaggctatacttaaaaatcctgatgacacaaccaaggtgtcactgctt
tatgctaatgtgtctccagatgacatactgcttaaacagaaacttgacctacttgcagct
gcccaccctaatttgaaggtctattacacagttgataatcctacaaagagttggaaagga
gggaaaggcttcatatcaaaggacatggcagttaaagggttacctggtccctctgaagat
actctcatccttgtatgcggtcctcctgggatgatggaacacatatctggaggcaaggct
aaagactggtcacaaggagagctctctggcatactaaaagaacttggctacacagaagaa
atggtttacaaattttga

DBGET integrated database retrieval system