KEGG   Fragaria vesca (woodland strawberry): 101304574Help
Entry
101304574         CDS       T02666                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101304574
Transfer RNA biogenesis [BR:fve03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101304574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 567 aa AA seqDB search
MATAVVAAAADPIRKQPRPGRGGFEAHGLSEEEARVRAIAEIVGSMVDLSRRGETVDLNA
LKTAACRKYGLARAPKLVEMIAALPESDREALLPKLKAKPVRTASGIAVVAVMSKPHRCP
HIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARGRIDQLKRLGH
SVDKVEYILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGATKCIGMTI
ETRPDYCLGPHLRQMLTYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFK
VVAHMMPDLPNVGVERDMESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNY
PPEQLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGLKCRD
VRTREAGIQDIHHQIKPDEVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNT
SCPELMGKCSIVRELHVYGTAVPVHGRDAGKLQHQGYGTLLMEEAERIARREHRSTKIAV
ISGVGTRHYYRKLGYELEGPYMVKYLD
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcggtggtggcggcggcagccgatcccatccgtaagcaaccccgtccgggc
cggggcgggttcgaagcccacggactctccgaagaagaggcccgcgtccgcgccatagcc
gaaatcgtcggctccatggtcgacctctcccgccgaggcgaaaccgtcgacctaaacgcc
ctcaaaaccgccgcgtgccgcaagtacggcctcgcacgtgcaccgaagctggtcgagatg
atcgccgcgcttccggaatcggaccgcgaggcgctgcttccgaagctgaaagccaagccg
gtccgaaccgcctccggaatcgccgtcgtggccgtgatgtcgaagcctcaccggtgccct
cacatcgccaccaccgggaatatttgcgtgtactgccccggtgggcccgattcggatttt
gagtatagtactcagtcttatactggatacgagcctactagcatgcgcgcaattcgagcc
agatacaacccgtatgttcaggctagaggtaggatagatcagctgaagcgattgggtcac
agtgtagacaaggttgagtacattttaatgggtggtacattcatgtcgttgccagcagat
taccgtgattactttattagaaatcttcatgacgcattatccggccatacttctgccaat
gttgaagaggcagttgcatactctgagcatggggctactaaatgtattggaatgaccatt
gaaacgaggccagattactgccttggacctcacttgagacaaatgcttacttatggttgt
acacgattggagattggagttcaaagtacatatgaggatgtggctcgtgatactaataga
ggtcacacagtagctgcagtggctgattgtttctgcttggcaaaggatgctggtttcaag
gttgttgcacacatgatgcctgatcttccaaatgtaggggttgagagagacatggaaagc
tttcgtgaattttttgagagccccttgttcagagcagatggacttaaaatttatccaaca
cttgtaatccgtggaactggactttatgagctctggaaaactggaaggtatagaaattac
ccacctgagcaacttgtggacatagtagccagaatcctagccatggtacccccttggaca
cgtgtttatagagttcagagggacattccaatgcctctagttacttctggagtagagaaa
ggaaaccttcgggagcttgctttagctcggatggaagacttgggcttaaagtgtcgtgat
gttcgaacacgagaagctggaattcaggacatacatcaccaaattaagccggatgaagtg
gaacttgttcgtcgtgattatacagcaaatgaaggttgggaaacatttctttcatatgaa
gatacacgccaggatattctagttgggttgttgcgattaagaaaatgcggcagaaatact
tcctgtcctgaactcatggggaagtgttctattgttcgtgaacttcatgtttatgggact
gctgttccagttcatgggcgggatgctggcaagctgcagcaccagggctacggtacactt
ttgatggaagaagcagagcgaattgctagaagggagcacagatcaaccaagatcgctgtt
atttcaggagtaggaactcgtcactactacagaaaattaggatatgaacttgaagggcca
tacatggttaaatatcttgactag

DBGET integrated database retrieval system