KEGG   Fragaria vesca (woodland strawberry): 101304831Help
Entry
101304831         CDS       T02666                                 

Definition
glutamate--glyoxylate aminotransferase 2-like
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Class
Metabolism; Overview; Carbon metabolism [PATH:fve01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:fve01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fve01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fve00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:fve00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fve00250]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fve00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Unknown
AA seq 481 aa AA seqDB search
MPPKALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLLFPADAISRAKHYLSVTSGGLGAYSDSRGIPAIRKEVAEFI
EKRDGYPSDPELIYLTDGASKGVMQILNAIIRGAGDGVLVPVPQYPLYSAAISLFGGSLV
PYYLEETANWGLDVTDLRQSVITARSKGITVRAMVIINPGNPTGQCLSEANLREIINFCI
QENLVLLGDEVYQQNVYQDERPFISARKVLMGMGPFISKELQLVSFHSVSKGYWGECGQR
GGYFEMTNIPPQTVDEIYKVASVALSPNVPAQIFMGLMVNPPKPGDISYDQFARESKEIL
ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKSAGKVPDVFYCLKL
LEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMEQYEDDRGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggcattggattatgaatcactgaatgagaatgtgaagaaggttcagtat
gctgttagaggcgagctatatcttcgagcttctgagcttcagaaggaaggaaagaagatc
attttcacaaatgttggaaatcctcatgctctcggacagaagcccctaactttccctcgc
caggtggttgctctatgtcaagctccatttttattagatgaccccaatgtaggactgctc
ttccctgctgatgcaatttcaagggctaaacattacctctcagttacttctggtggtcta
ggtgcttacagtgattctcgaggtattcctgcaattaggaaggaagtggcagagttcatt
gaaaaacgtgatggttatccaagtgacccagaactcatatatctcactgatggtgccagt
aaaggtgtaatgcagatcttaaatgccataatccgtggtgcaggggatggggttttggtt
ccagttccacaataccctctttactcagctgcaatatctctatttggtggttctcttgtt
ccgtattacctggaagaaactgcgaactggggtcttgatgttactgatcttcgccagtca
gtcataacagctcgctccaaaggaattactgtgagagcaatggtgattataaaccctggt
aaccctactggtcagtgtcttagtgaagctaatttaagagagataataaacttctgtatc
caagaaaacctggtcttgcttggtgatgaagtttatcagcagaatgtataccaggatgag
cgcccctttattagtgctagaaaggtgttgatgggtatggggccattcataagcaaggag
ctccagcttgtttctttccactctgtgtcaaaaggatattggggtgaatgtggacagcgt
ggtggatactttgagatgacaaacattcctccacagacagttgatgagatatataaggtt
gcatcagtggcactcagtccaaatgttcctgcacaaatatttatgggccttatggtcaac
cctcccaaacctggagatatttcatatgaccagtttgctagggaaagcaaagagatcctt
gaatctctgaggagaagagcacgtttaatgactgatggattcaacagctgcagaaacgta
gtttgtaatttcactgaaggtgccatgtattccttccctcaaatacgcttgccaccaaga
gcaattcaggctgctaaaagcgctggaaaagttcctgatgtattctactgtctcaagctt
ttggaagccaccggcatttccactgttcctggttcagggtttggacagaaagatggggtc
ttccacttgaggacaaccatcttaccagctgaggaagacatgcctgctatcatggacagt
ttcaagaagttcaacaatgagttcatggagcaatatgaagatgacagaggttattcaagg
atgtga

DBGET integrated database retrieval system