KEGG   Fragaria vesca (woodland strawberry): 101306313Help
Entry
101306313         CDS       T02666                                 

Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K20536  
mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:fve00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    101306313
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101306313
Protein kinases [BR:fve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101306313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG3
AA seq 371 aa AA seqDB search
MADHLPSGNGDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSE
TNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVVAIRDVIPPPVRREFSDVYIAA
ELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLK
ICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLF
PGKDHVNQMRLLTELLGTPTESDLGFVRNEDARRYIRQLPQFPRQQMVKLFPHVHPLAID
LVDRMLTFDPTKRITVEEALAHPYLERLHDVADEPICTVPFSFDFEQQSLGEEQMKDMIY
REAIAFNPEYA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccacctcccctccggcaacggcgacttcccggcggttccgtcgcacggcggc
cagtacattcagtacaacattttcgggaacctcttcgagatcaccaacaagtaccgccct
ccgatcatgccgatcggccgcggcgcatacggcatcgtctgctcggtgttgaattcggag
acgaacgagatggtggcgatcaagaaaatcgccaacgcttttgataatcacatggacgcc
aagcgcacgctccgtgagattaagctgcttcgtcatttggatcatgaaaatgtcgtagct
attagggatgtgattcctccacctgttaggagggaattttcagacgtatacattgccgcg
gaactcatggatactgatcttcatcagattattcgctcgaatcaaggtttatctgaagag
cattgtcagtacttcttgtatcagattcttcgaggactgaagtatatacattcggcaaat
gttattcatagagacttgaagccgagcaacctgttgttgaatgctaactgtgacctgaag
atatgtgattttggccttgcccgtccgactgctgagaatgagttattgactgagtatgtt
gtcactagatggtacagggcacctgagctattgttgaactcttctgactatactgcagca
atagatgtttggtctgtgggttgtatatttatggagcttatgaatagaaagcctctattt
cctggcaaagatcatgtgaatcagatgcgcctactgacagagcttcttgggacaccaact
gagtctgatcttgggtttgttcgaaatgaggatgccagaagatatattcgacagcttccc
caatttcctcgtcagcaaatggtgaagcttttcccacatgttcatccattggccattgat
ttagtggatagaatgttaacatttgatcccactaaaaggataacagttgaagaagcatta
gctcatccttacctggaaagactgcatgacgtagctgatgaaccaatctgtactgttcca
ttctcttttgattttgagcaacaatccttgggagaagagcaaatgaaagatatgatatac
agagaggctatagcattcaatcctgagtatgcttga

DBGET integrated database retrieval system