KEGG   Fragaria vesca (woodland strawberry): 101306313Help
Entry
101306313         CDS       T02666                                 

Definition
mitogen-activated protein kinase 3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101306313
Protein kinases [BR:fve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101306313
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101306313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 371 aa AA seqDB search
MADHLPSGNGDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSE
TNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVVAIRDVIPPPVRREFSDVYIAA
ELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLK
ICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLF
PGKDHVNQMRLLTELLGTPTESDLGFVRNEDARRYIRQLPQFPRQQMVKLFPHVHPLAID
LVDRMLTFDPTKRITVEEALAHPYLERLHDVADEPICTVPFSFDFEQQSLGEEQMKDMIY
REAIAFNPEYA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccacctcccctccggcaacggcgacttcccggcggttccgtcgcacggcggc
cagtacattcagtacaacattttcgggaacctcttcgagatcaccaacaagtaccgccct
ccgatcatgccgatcggccgcggcgcatacggcatcgtctgctcggtgttgaattcggag
acgaacgagatggtggcgatcaagaaaatcgccaacgcttttgataatcacatggacgcc
aagcgcacgctccgtgagattaagctgcttcgtcatttggatcatgaaaatgtcgtagct
attagggatgtgattcctccacctgttaggagggaattttcagacgtatacattgccgcg
gaactcatggatactgatcttcatcagattattcgctcgaatcaaggtttatctgaagag
cattgtcagtacttcttgtatcagattcttcgaggactgaagtatatacattcggcaaat
gttattcatagagacttgaagccgagcaacctgttgttgaatgctaactgtgacctgaag
atatgtgattttggccttgcccgtccgactgctgagaatgagttattgactgagtatgtt
gtcactagatggtacagggcacctgagctattgttgaactcttctgactatactgcagca
atagatgtttggtctgtgggttgtatatttatggagcttatgaatagaaagcctctattt
cctggcaaagatcatgtgaatcagatgcgcctactgacagagcttcttgggacaccaact
gagtctgatcttgggtttgttcgaaatgaggatgccagaagatatattcgacagcttccc
caatttcctcgtcagcaaatggtgaagcttttcccacatgttcatccattggccattgat
ttagtggatagaatgttaacatttgatcccactaaaaggataacagttgaagaagcatta
gctcatccttacctggaaagactgcatgacgtagctgatgaaccaatctgtactgttcca
ttctcttttgattttgagcaacaatccttgggagaagagcaaatgaaagatatgatatac
agagaggctatagcattcaatcctgagtatgcttga

DBGET integrated database retrieval system