KEGG   Fragaria vesca (woodland strawberry): 101306979Help
Entry
101306979         CDS       T02666                                 

Definition
histone deacetylase 2-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101306979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 350 aa AA seqDB search
MSLAPPSETDAESLRRSRILSSKLYFDVPSSKVPLIYSSSYDIAFLGIEKLHPFDSAKWG
RICRFLSMDDVVEKNCLVEPKQASKEDLLVVHTEAYLKSLKSSLDVAMIIEVPPVALFPN
CLVQQKVLGPFRNQVGGTILAAKLAKERGWAINVGGGFHHCCGAKGGGFCAYADISLCIH
FAFVWLNISRVMIIDLDAHQGNGHETDFANDSRVYILDMYNPGIYPFDYEARRYIDQRVE
VPSGTTTAEYLRKLDEALEVAAHNFEPELVVYNAGTDILDGDPLGRLKISPDGITHRDEK
VFKFARERNIPIVMLTSGGYMKSSARVIADSITNLSNKSLIDTGRNRTST
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgctcctccgtcggaaaccgacgccgaatctctcaggcgcagccgtattctc
tccagcaagctctacttcgacgtcccgagctccaaggttccgttgatttactcttcgagt
tatgatatcgcatttctcggcatcgagaagctgcacccgttcgattctgctaaatggggc
cggatatgtagattcctatccatggatgatgttgtggagaagaattgccttgtggagcca
aagcaagcttcaaaggaagatcttcttgtggtgcatactgaagcatacttgaagagtttg
aagagtagtttagatgttgctatgataattgaggtacctcctgttgccctattcccaaac
tgccttgtacagcagaaagttctcgggccatttcgcaaccaggtggggggaactatcttg
gctgcaaagcttgcaaaagagcgaggatgggccatcaatgtgggaggagggtttcatcat
tgttgtggggcaaaaggaggtggattctgtgcttatgccgatatttctctttgcatacat
tttgcctttgtgtggttaaacatatcaagggtcatgattattgatcttgatgcacatcaa
ggaaatggccatgaaacggattttgcaaatgacagtcgagtctatatcctggatatgtac
aaccctggaatatatccatttgattatgaggcaaggagatacattgatcagagggttgaa
gtaccgagtggcactacaacagccgagtacttgaggaagttagatgaagctcttgaggtt
gctgctcataattttgaacctgagttggtagtatacaatgctggaactgatattctcgat
ggagatcctctgggcaggttgaagatcagtcctgatgggataactcacagggatgagaaa
gtcttcaagtttgctcgggagagaaatattcccattgtcatgctcacatcaggtggttac
atgaagtcaagtgcaagagttatagcagactcgataaccaacctctcaaataaatccttg
attgatacggggagaaacagaacttctacatga

DBGET integrated database retrieval system