KEGG   Fragaria vesca (woodland strawberry): 101307619Help
Entry
101307619         CDS       T02666                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101307619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 460 aa AA seqDB search
MGQKKGPPADDTLEPKKRRRVGFSSVDAGVEAKDCIKIFLVSSKEEVDAANSFCLDPVDL
NSFFEEDGKIYGYKGLKITIWVSSISFDAYADIAFESTADGGKGITDLKSALEKIFGETL
VASKEEFLQTFSTQRNFIRSMISDGEVLQHKASSTSDVEAIRMVVGKSAAGPLYSRLVPL
VFLLVDGASAIDVLDPCWELYLLVKKKTDEQGDIYNILLGFTALYRFYHYPDSSRLRLSQ
ILVLPPYQHKGYGRYILEVLNHVAVSEDVYDFTVEEPLDYFQHVRTCVDVLRLQKLDSVR
NAVNLAVSNLTRGKLSKKTSIPRLMPATRVIEDVRKSLKINKKQFLQCWEVFIYLGLDPV
SKYMEDFVSIVSNRMKEDIIGKESGTGGKQVIEVPSEYIPEMSFVLFKSNAGEATSTVQV
DENKPTQAEQLQELVDERVNEIKSIAEKVSQHSTSMVESS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgggccagaagaaaggaccccccgccgacgacactctcgagcccaagaaacgccgccgc
gtcggcttctccagcgtcgatgctggagtggaggccaaggattgcatcaagatttttctg
gtttctagcaaagaagaggtggatgctgcaaacagtttttgtttggatccggttgacttg
aatagcttttttgaggaagatgggaagatatatggttacaaaggattgaagattaccata
tgggttagcagtatatcgtttgatgcatatgctgatattgcatttgagagcacagctgat
ggaggtaaaggaatcacagatttgaaatcagctcttgagaaaatatttggtgagaccctt
gttgccagtaaagaggagttccttcagaccttctcaactcagagaaatttcatcagatcc
atgatctcagacggggaggtgttgcagcacaaggcttcatctacttctgatgtggaggct
atccgcatggttgtgggcaagtcagctgctggacccctatacagtcgcttggttcctctt
gtgtttcttcttgttgatggtgccagtgcaattgatgtattggatccatgttgggagttg
tatctcctggtcaagaagaaaacagatgagcaaggggacatctataatatattgctcggc
tttacagctctgtatcgtttttatcattatccagacagttctcggttgcgacttagccag
attctcgtattgcctccttaccagcataagggttatggacggtacattctagaggttctc
aatcatgttgcagtatctgaagatgtctatgacttcacagtagaagaaccattggactac
ttccaacatgtacgcacttgtgttgatgtgctacgccttcagaaattagattctgttcgc
aatgcagtcaatttggctgtttcaaatctgacacgaggaaaactgtcaaagaaaacgagc
atccctcgactgatgccagccacaagagtcattgaggatgtgaggaaaagcttgaagatc
aacaagaaacaatttctgcaatgttgggaggtcttcatctatcttggcctcgatccagtg
agcaagtacatggaggattttgtgagcattgtttctaatcgcatgaaggaagatatcata
ggaaaagaatctgggactggtgggaagcaagtaattgaagttccaagcgaatacataccg
gagatgtcatttgttctgttcaagtccaatgctggtgaagctactagtactgttcaggta
gatgaaaacaagccgacacaggcggagcaacttcaggagttagttgatgagagagtgaat
gagatcaaatcaatagcagagaaagtatctcagcatagcacgagtatggtcgagtcatct
taa

DBGET integrated database retrieval system