KEGG   Fragaria vesca (woodland strawberry): 101307745Help
Entry
101307745         CDS       T02666                                 

Definition
(RefSeq) probable choline kinase 1 isoform X1
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101307745
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101307745
    2.7.1.82  ethanolamine kinase
     101307745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 343 aa AA seqDB search
MAIKAIGFIEGCLPEELKKVLVSIASEWGDVVDDMNALQVIPLKGAMTNEVYQLNWPTKN
GDQLRKVLVRVYGEGVDLFFNRDDEIRTFECMSKHGQGPRLLGRFPEGRVEEFIHARTLS
AADLRDPETSAIIAAKLREFHNLEMPGSRNVVLWDRMRNWLSEAKTLCSVKDKKDFGLDT
LEEEINMLEKKLSEDCQDIGFCHNDLQYGNIMMDEETRSITIIDYEYASYNPVAYDLANH
FCEMVANYHSEAPHFLDYRKYPGLDERQRFVRLYLSSAEYEPSDAEVAQLVDKVEQYTLA
NHLFWGLWGIISGYVNKIEFDYMEYARQRFQQYWLRKPALLGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggccataaaggcaattggtttcattgaaggttgtctacctgaggaattaaagaaggta
cttgtatctatagcttctgaatggggggatgtagtggatgatatgaatgccttgcaggtc
atcccgttgaagggggccatgactaatgaggtgtaccaattaaactggccgactaagaat
ggtgatcaactccggaaagttctggtccgggtttatggagaaggggttgacctgtttttc
aatagggatgatgaaattaggacctttgagtgcatgtccaagcacggtcaggggccccgt
cttcttggacggttcccagagggacgtgttgaggagttcattcatgctaggacactatca
gctgctgacctccgtgatcctgaaacatctgctattatagcagctaagctgagggagttc
cacaatctggagatgcctggttcaagaaatgtagtactttgggacagaatgagaaactgg
cttagtgaggctaaaactttgtgttcagtaaaggacaaaaaggattttgggttggatact
ttggaggaagaaattaacatgttggagaagaaactgtcagaggactgtcaagacattggc
ttctgtcacaatgacttgcagtacggtaacataatgatggatgaagaaaccagatcaatc
actataatcgattatgaatatgccagttacaatcctgttgcttatgaccttgcgaatcat
ttctgtgaaatggtagcaaactaccactctgaggcacctcactttttggactacaggaaa
tatccaggtctggatgagcgccagagatttgtgcgtctatatctgagctctgcagagtac
gaacccagtgatgctgaggtggcacaattggtcgacaaagtagagcagtacacattggca
aaccatctcttttgggggttatggggaataatctcgggttatgtgaacaaaattgaattt
gactacatggagtacgcgaggcagaggtttcagcaatattggttaagaaaacctgcatta
ttgggttcttga

DBGET integrated database retrieval system