KEGG   Fragaria vesca (woodland strawberry): 101308284Help
Entry
101308284         CDS       T02666                                 

Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101308284
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     101308284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 383 aa AA seqDB search
MVTAASVGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEID
SEDIKVREKCREELKKAAIDWGVMHLVNHGISDELMERVKKAGKAFFDLPIEQKEKYAND
QASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPSDYIVATSEYAKEL
RGLTTKILSILSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDIS
ALTFILHNMVPGLQLFYGGKWVTAKCVPNSIVMHIGDTLEILSNGKYKSILHRGLVNKEK
VRISWAVFCEPPKEKIILKPLPETVSEEEPAIFPPRTFFEHIQHKLFRQSQEALVSTKES
AALKSTKESALKSTKEAALISTN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgctgcatccgttggttcaagagtcgagagtttggccagcagcgggatctca
acgatcccaaaggagtacgtgagacccgaagaggagctcgttaacatcggtgacatcttc
gaagacgagaagagcaccgaagggcctcaagtacctaccattgatttgaaggagatagac
tcggaggacatcaaggtgagggagaaatgtagggaggagttgaagaaagcagccatcgac
tggggtgtcatgcaccttgtcaaccatggcatctccgacgagctcatggaacgggtcaag
aaggccggaaaagccttctttgatcttcccattgagcagaaggagaagtatgccaatgat
caggcctccggcaaaattcaaggctacggaagcaagcttgcaaacaatgcttccggccaa
cttgagtgggaggactactttttccactgtgtttatcctgaggacaagcgtgacttgtcc
atttggcctcaaacaccttccgactatattgtggcaacaagtgagtatgctaaggaactg
agggggttaacaaccaagatactgagcatactctcacttggcttgggattagaagaaggg
aggctggagaaggaggtcggtggactcgaagaactcctcctgcaaatgaagatcaactac
tacccaaaatgccctcagccggaacttgcactcggcgtggaagctcatacagacataagt
gcactcaccttcatcctccacaacatggttcccggcctgcagctcttctacggcggcaaa
tgggtgacagcgaagtgcgtacccaactccatcgtcatgcacataggcgacaccttagag
attctaagcaacggcaagtacaagagcattcttcacagggggctcgtcaacaaggagaag
gtgaggatctcgtgggcggttttctgtgagccgcccaaggagaagatcatccttaagccg
ctaccggaaactgtctccgaggaggagccggcgatcttcccaccacggactttcttcgag
catatccagcacaaactgttcaggcagagccaggaagctctcgtctctaccaaagaatct
gctgccctcaaaagcactaaagaatctgccctcaaaagcactaaagaagctgctctcatc
tcaactaattag

DBGET integrated database retrieval system