KEGG   Fragaria vesca (woodland strawberry): 101308284Help
Entry
101308284         CDS       T02666                                 

Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:fve00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 383 aa AA seqDB search
MVTAASVGSRVESLASSGISTIPKEYVRPEEELVNIGDIFEDEKSTEGPQVPTIDLKEID
SEDIKVREKCREELKKAAIDWGVMHLVNHGISDELMERVKKAGKAFFDLPIEQKEKYAND
QASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPSDYIVATSEYAKEL
RGLTTKILSILSLGLGLEEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDIS
ALTFILHNMVPGLQLFYGGKWVTAKCVPNSIVMHIGDTLEILSNGKYKSILHRGLVNKEK
VRISWAVFCEPPKEKIILKPLPETVSEEEPAIFPPRTFFEHIQHKLFRQSQEALVSTKES
AALKSTKESALKSTKEAALISTN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgctgcatccgttggttcaagagtcgagagtttggccagcagcgggatctca
acgatcccaaaggagtacgtgagacccgaagaggagctcgttaacatcggtgacatcttc
gaagacgagaagagcaccgaagggcctcaagtacctaccattgatttgaaggagatagac
tcggaggacatcaaggtgagggagaaatgtagggaggagttgaagaaagcagccatcgac
tggggtgtcatgcaccttgtcaaccatggcatctccgacgagctcatggaacgggtcaag
aaggccggaaaagccttctttgatcttcccattgagcagaaggagaagtatgccaatgat
caggcctccggcaaaattcaaggctacggaagcaagcttgcaaacaatgcttccggccaa
cttgagtgggaggactactttttccactgtgtttatcctgaggacaagcgtgacttgtcc
atttggcctcaaacaccttccgactatattgtggcaacaagtgagtatgctaaggaactg
agggggttaacaaccaagatactgagcatactctcacttggcttgggattagaagaaggg
aggctggagaaggaggtcggtggactcgaagaactcctcctgcaaatgaagatcaactac
tacccaaaatgccctcagccggaacttgcactcggcgtggaagctcatacagacataagt
gcactcaccttcatcctccacaacatggttcccggcctgcagctcttctacggcggcaaa
tgggtgacagcgaagtgcgtacccaactccatcgtcatgcacataggcgacaccttagag
attctaagcaacggcaagtacaagagcattcttcacagggggctcgtcaacaaggagaag
gtgaggatctcgtgggcggttttctgtgagccgcccaaggagaagatcatccttaagccg
ctaccggaaactgtctccgaggaggagccggcgatcttcccaccacggactttcttcgag
catatccagcacaaactgttcaggcagagccaggaagctctcgtctctaccaaagaatct
gctgccctcaaaagcactaaagaatctgccctcaaaagcactaaagaagctgctctcatc
tcaactaattag

DBGET integrated database retrieval system