KEGG   Fragaria vesca (woodland strawberry): 101308431Help
Entry
101308431         CDS       T02666                                 

Definition
polyprenol reductase 2-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101308431
    1.3.1.94  polyprenol reductase
     101308431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 342 aa AA seqDB search
MGMEVGVVELVRTGWIAGTLPILIASLPLSCLNSFHDIVLGFAKRGKILQSSSSKRFTVP
QKFFWHFYVLAVVWTTLLLATTWTYAYKMVPLNADPFLYSTFANRITGGSHILSWRKSPS
IPIGYRYSVWRSVFLLLLMEVQVVKRLIETIYVFKYSSTARMHIFGYLTGLFFYTAAPLS
LCCNHIPEVYNYSVNGVAEFIVKGKKYTMQDLDFNWLEFTSSLLKLGWLQWIGAAIFFWG
WFHQGRCHDILGSLREDSEQSDEYVIPHGDWFKFVSSPHYLAEIVIYAGLVVASGGADLT
IWLLFGFVVSNLVFTAAETHRWYLQKFKSYPRNRRAIIPFLY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggggatggaggtgggtgttgttgagttggtgagaactggttggattgcagggacattg
cctatactgatagcttcgttgcccttgtcttgcctcaactcctttcatgacatcgttttg
ggttttgccaagagaggcaagatcttgcaatcttcttcttctaagagattcacagttcct
caaaagttcttctggcatttctatgtgctggctgtcgtgtggacaaccctacttcttgca
acaacttggacatatgcatataaaatggtgccactgaatgcggacccatttctttattct
acattcgccaaccgcattactggaggttcacatatcctctcctggcgcaagtctccatca
attcctataggttatagatatagtgtctggcgttctgtctttttgcttttgttgatggaa
gttcaagttgtgaagcgccttattgagacaatatatgtattcaagtatagctccactgct
aggatgcacatctttgggtatctgactggcctctttttctatacagctgcacccttgtca
ctttgctgcaatcatattccagaggtgtataactattccgttaatggagtggctgagttt
attgtcaaaggcaagaagtatactatgcaagatctggattttaattggttggaatttact
agttctcttctgaagcttggttggctccagtggattggtgctgctatattcttttggggt
tggtttcatcagggccgctgtcatgatattcttggctcattacgagaagacagtgaacaa
agtgacgaatatgtgattcctcatggtgattggtttaaatttgtctcatctccacattat
cttgctgagatagttatatatgctggtcttgtggttgctagtggaggagcagacctcaca
atctggttattatttggattcgtggtgtcgaacttggtatttacagcagcagaaacacat
aggtggtaccttcagaagttcaaaagttacccaagaaatcggcgtgccattattccattc
ttatactaa

DBGET integrated database retrieval system