KEGG   Fragaria vesca (woodland strawberry): 101308652Help
Entry
101308652         CDS       T02666                                 

Definition
mitogen-activated protein kinase homolog NTF6-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 365 aa AA seqDB search
MENKIVEAKQPPGYVQYNLLGNLFQVSDKYVPPISPVGRGAYGIVCCATNSETKEEVAIK
KIGNAFDNRIDAKRTLREIKLLSHMDHDNIVKIKDIIRPPDKENFNDVYIVYELMDTDLN
QIISSSQPLTDDHCQYFLYQLLRGLKYIHSAHVLHRDLKPSNLLLNANCDLKICDFGLAR
TTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCIFMEILIREPLFPGKDYVQQ
LSLITELLGSPEDSNLGFLRSENAKKYVKQLPHVPKQPFAQKFPNVSPVAIDLAEKMLVF
DPSKRITVEEALNHPYLSSLHAINEEPICPSPFIFDFEQASLDEEDIKELVWRESLNFNP
DNMQE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagaataagatagttgaagctaaacagcctcctgggtatgttcagtacaaccttctg
ggtaatctttttcaggtttctgacaagtatgtccctcccatcagcccagttggccgcggc
gcctacggtattgtttgctgcgcaacaaactctgagacaaaagaagaggttgcaatcaag
aagattgggaatgcatttgacaataggatcgatgccaagaggacgctccgagagataaag
ctcctttcccatatggatcatgacaatattgtcaaaattaaggacatcataaggccacca
gataaggagaacttcaatgatgtttacattgtgtatgaattgatggatactgacctgaat
cagataataagctccagccagcctttgactgatgatcactgtcagtactttctgtatcag
ttgctgcggggattgaagtacatacactctgcacatgttttgcaccgtgatctgaaacca
agcaatctgcttctcaatgctaattgtgatcttaagatttgtgactttgggcttgcaaga
actacatcagagacagatttcatgacagaatatgttgtcactcgttggtatcgagcccca
gaattactactcaactgttctgaatacactgcagcaatagatatttggtcagtgggatgc
attttcatggagattctgataagggaaccgttatttcctggtaaagactacgtacagcag
ttgagtctcataactgagctactaggttcaccggaagattcaaaccttggcttcctgaga
agtgaaaatgctaagaaatatgttaagcagctcccacatgtcccaaagcaaccctttgcg
cagaagttcccaaatgtctcaccagtggcaattgatcttgcagaaaaaatgctagttttt
gatccaagcaaacgtataactgttgaggaagcattgaatcatccatatctatcgagtctt
catgcgatcaacgaggagcccatttgcccatctcctttcatctttgattttgagcaggca
tccctggatgaagaagacataaaggagctcgtatggagggagtctctgaacttcaaccca
gataatatgcaggaataa

DBGET integrated database retrieval system