KEGG   Fragaria vesca (woodland strawberry): 101308652Help
Entry
101308652         CDS       T02666                                 

Definition
mitogen-activated protein kinase homolog NTF6-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101308652
Protein kinases [BR:fve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101308652
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101308652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 365 aa AA seqDB search
MENKIVEAKQPPGYVQYNLLGNLFQVSDKYVPPISPVGRGAYGIVCCATNSETKEEVAIK
KIGNAFDNRIDAKRTLREIKLLSHMDHDNIVKIKDIIRPPDKENFNDVYIVYELMDTDLN
QIISSSQPLTDDHCQYFLYQLLRGLKYIHSAHVLHRDLKPSNLLLNANCDLKICDFGLAR
TTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCIFMEILIREPLFPGKDYVQQ
LSLITELLGSPEDSNLGFLRSENAKKYVKQLPHVPKQPFAQKFPNVSPVAIDLAEKMLVF
DPSKRITVEEALNHPYLSSLHAINEEPICPSPFIFDFEQASLDEEDIKELVWRESLNFNP
DNMQE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagaataagatagttgaagctaaacagcctcctgggtatgttcagtacaaccttctg
ggtaatctttttcaggtttctgacaagtatgtccctcccatcagcccagttggccgcggc
gcctacggtattgtttgctgcgcaacaaactctgagacaaaagaagaggttgcaatcaag
aagattgggaatgcatttgacaataggatcgatgccaagaggacgctccgagagataaag
ctcctttcccatatggatcatgacaatattgtcaaaattaaggacatcataaggccacca
gataaggagaacttcaatgatgtttacattgtgtatgaattgatggatactgacctgaat
cagataataagctccagccagcctttgactgatgatcactgtcagtactttctgtatcag
ttgctgcggggattgaagtacatacactctgcacatgttttgcaccgtgatctgaaacca
agcaatctgcttctcaatgctaattgtgatcttaagatttgtgactttgggcttgcaaga
actacatcagagacagatttcatgacagaatatgttgtcactcgttggtatcgagcccca
gaattactactcaactgttctgaatacactgcagcaatagatatttggtcagtgggatgc
attttcatggagattctgataagggaaccgttatttcctggtaaagactacgtacagcag
ttgagtctcataactgagctactaggttcaccggaagattcaaaccttggcttcctgaga
agtgaaaatgctaagaaatatgttaagcagctcccacatgtcccaaagcaaccctttgcg
cagaagttcccaaatgtctcaccagtggcaattgatcttgcagaaaaaatgctagttttt
gatccaagcaaacgtataactgttgaggaagcattgaatcatccatatctatcgagtctt
catgcgatcaacgaggagcccatttgcccatctcctttcatctttgattttgagcaggca
tccctggatgaagaagacataaaggagctcgtatggagggagtctctgaacttcaaccca
gataatatgcaggaataa

DBGET integrated database retrieval system