KEGG   Fragaria vesca (woodland strawberry): 101309287Help
Entry
101309287         CDS       T02666                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member F1
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101309287
   00040 Pentose and glucuronate interconversions
    101309287
   00053 Ascorbate and aldarate metabolism
    101309287
   00620 Pyruvate metabolism
    101309287
  Lipid metabolism
   00071 Fatty acid degradation
    101309287
   00561 Glycerolipid metabolism
    101309287
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101309287
   00310 Lysine degradation
    101309287
   00330 Arginine and proline metabolism
    101309287
   00340 Histidine metabolism
    101309287
   00380 Tryptophan metabolism
    101309287
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101309287
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101309287
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101309287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 558 aa AA seqDB search
MTFTYILLISSQVLKCIACGDLVGWVPSMSFIDRRIYGVCLCNYISMTKLARGTRKLEER
NQTNAVRRLCNITMEAMSEIAEATLRELRETFRSGRTRSVAWRKTQLSALRELIRDNEEK
IFEGLYQDLGKHPIEAYRDEVGVLIKSINYALSNLDKWVATKKGKLPLLLFPARGELVPE
PLGVVLIFASWNYPISLALEPVIGAIAAGNTVVLKPSDQSPACSSIIAKTIPQYMDPKAI
RIIEGGAQISEILLQHKWDKIFFTGSPQVGRAVMTAAAKHLTPVTLELGGKCPVILDSLS
NPSDLKVAIKRIVSGKWGPCSGQACIGVDYMLVEEKFAPTVIELLKKTIKKFYTESPKDA
NCIARIVNKKHFQRVQNLLKEPLVEASIVHGGSLDEEKLFIEPIVLLNPPLDSAIMNEEI
FGPLLPVITLKNIQESIEFINTRPKPLTIYAFTKDENFKKKILSETSSGGVTFNDVLIQF
ICDTLPFGGVGSSGFGRYHGKFSFDTFSHEKAVFQGGFFPELEPRYPPWNNFKMKFIRLA
YDLDYFGLVLLLLGLKRY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacttttacctatattctcttgattagtagtcaggtattgaagtgtatagcatgtggt
gacctcgttggttgggtgccttcaatgtcatttattgatcgtcgaatctatggtgtatgc
ttatgtaactatatatccatgacaaagttggcaagaggcacacgaaaactagaagagaga
aatcaaacgaacgctgtcagaagactctgtaatatcaccatggaagcaatgtcagaaata
gcagaagctacactgcgtgagctgagggaaaccttcaggagtggtagaaccagaagtgtt
gcatggaggaaaacccaactcagtgctcttcgtgagctcatcagagataatgaggaaaag
atctttgaaggactctatcaagatcttggcaagcacccaattgaagcttacagggatgag
gttggagttctgatcaaatcaattaattatgctttgagcaatttagacaaatgggtggca
accaaaaagggtaaattaccgttgcttttatttccggcaagaggagagctggtgccggaa
ccactcggcgtagttctcatctttgcatcttggaactacccaatatctttggctttggaa
cctgtaataggagcaatagctgcagggaacacagtggttctaaaaccttcagaccaatca
ccagcatgttcttccataattgctaaaaccatccctcaatacatggaccctaaagccatt
agaatcatcgagggtggagcacaaattagtgaaattctcctgcagcacaagtgggataag
atattctttactggtagtccgcaggtagggcgcgctgtcatgactgcagctgctaagcat
ttaacacctgttacactagagctgggcggaaaatgccctgtcatccttgattcactttcc
aatccttcggatctaaaggtggcaatcaaaagaattgtaagtggaaagtggggtccttgc
agtggccaggcatgtataggagtagattatatgctcgttgaggaaaagtttgctcccact
gtgatcgagttgttgaagaaaacgatcaagaaattttataccgaaagcccaaaagacgca
aattgcattgccagaattgtaaataagaagcactttcagagagtgcagaatctcctcaaa
gaacctcttgttgaggcttccattgtacatggtggctcactggatgaagaaaaactgttc
attgagccaatagtcttgttaaatcccccacttgattctgcaatcatgaatgaagaaatc
tttggcccactgcttccagtaatcactttgaagaacattcaggaaagcattgaattcata
aacacacggccaaaacctctgaccatttacgccttcaccaaagatgaaaacttcaagaag
aaaattttatcagaaacatcctccgggggtgtgactttcaatgacgtcttgattcaattt
atctgtgatactctaccctttggtggtgttggttctagtggatttgggaggtaccatggg
aagttttctttcgacactttcagccacgaaaaagcagttttccaaggaggcttcttccct
gaacttgagcctagatatcctccttggaacaacttcaaaatgaaattcatcagacttgcc
tatgatcttgactactttggactagttctgctcctacttggacttaaaaggtattag

DBGET integrated database retrieval system