KEGG   Fragaria vesca (woodland strawberry): 101309835Help
Entry
101309835         CDS       T02666                                 

Definition
histone deacetylase 6-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 464 aa AA seqDB search
MMDSSGASLPSGPDATKRRVSYFYEPTVGDYYYGQGHPMKPHRIRMAHNLIVHYGLHRRM
EINRPFPAAPADIRKFHSDDYVDFLASVSPETLSDAVHSRHLKRFNVGEDCPVFDGLFGF
CQASSGGSIGAAVKLNRTDCDIAINWAGGLHHAKKSEASGFCYVNDIVLGILELLKVHRR
VLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDVGAGPGKNYALNVPLN
DGMDDENFRSLFRPLIQKVMEMYQPDAVVLQCGADSLSGDRLGCFNLSVKGHADCLRYLR
SFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPENKLPYNEYYEYFGPDYTLHVDTCN
MENLNTPKDMENIRNTLLEQLSRLPHTPSVPFQTTPPITEVPEEAEERMDHRPKRRIWDG
VDYDSDPDDDDEKPWNPAGLRGFDMGMRDDPDEMEEDEDHPPCC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatggactcaagcggagcttcactgccgtcgggccccgacgcaacgaagcggcgcgtg
agctacttctacgagcccaccgtcggcgactactactacggccaaggccaccccatgaag
ccccaccgcatccgcatggcccacaacctgatcgtccactacggcctccaccgccgcatg
gagatcaaccgccccttccccgccgcccccgccgacatcagaaagttccactccgacgac
tacgtcgacttcctcgcctccgtctcccccgaaaccctctccgacgccgtccactcccgc
cacctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggcctcttcggcttc
tgccaggcctcctccggcggctctatcggcgccgccgtcaagctgaaccggaccgactgc
gatatcgccatcaattgggccggcggtctccaccatgccaagaagtctgaggcctcaggg
ttttgctacgtcaacgacatcgtgctcggcattctggagcttctcaaggttcacaggcgt
gttctttatatagacattgatgtgcaccacggagatggagttgaggaggcattttacacc
actgacagggtaatgaccgtgtccttccataagtttggcgatttctttccagggactggg
catatcaaggatgtcggagcagggcctgggaaaaattatgccttgaatgtcccactgaat
gatggcatggatgacgagaattttcggagtctgtttaggcccctcatccagaaggtcatg
gagatgtatcagccagatgcagttgttcttcagtgtggagcagattcactgtctggtgat
cggttggggtgcttcaacttatctgtcaaaggtcatgctgattgtcttcgctatcttcgt
tcattcaatgttcctttgatggttttgggcggtggaggatacacgatcaggaatgttgct
cgttgctggtgctatgagacagctgttgctgttggggtggagcctgaaaataaactgcct
tacaatgaatactatgagtattttggcccagattacactctacacgttgacacttgcaac
atggagaacctaaacacacccaaagacatggagaatataaggaatacactgctggagcaa
ctctctaggttacctcatacaccaagtgtccctttccagacaacaccaccaattacagaa
gtcccagaggaggcagaagagcgcatggaccacagaccaaagcgtcgcatttgggatggc
gtggactatgattctgatccggatgacgatgatgagaagccttggaatcctgctggtctc
cgtggttttgatatgggaatgagggatgatcctgatgagatggaagaagatgaagatcat
cctccgtgttgttag

DBGET integrated database retrieval system