KEGG   Fragaria vesca (woodland strawberry): 101309897Help
Entry
101309897         CDS       T02666                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101309897
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101309897
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101309897
  Exosomal proteins of colorectal cancer cells
   101309897
  Exosomal proteins of bladder cancer cells
   101309897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 498 aa AA seqDB search
MTSSRVLLCFSLLVALCFTAIHADEADSKEFVLTLDSSNFSDTISKHDFVVVEFYAPWCG
HCKKLAPEYEKAASILSSLDPPVILAKVDANEEANKGLATDYDVKGFPTIKILRDGGKII
QEYKGPREADGIVSYLKKQSGPASVELKSADDATTLVGEKKIVVVGVFEKFSGDEYEKFL
SLAQKLRSDYEFGHTLDAKHLPRGDSSVTGPVVRLFKPFDELFVDFKEFNAEALEKFIEE
SSLPVVTEFNNDPDNHPFVIKFFNGQNDKAMLFLNFSSDAADAFKSKYREVAEKYKGEGI
SFLVGDLEASQGAFQYFGLKEDQVPLIIIQTNDGQKFLKPHLEPDHISVWVREYKDGKVP
AYKKSEPIPEKNDEPVKVIVAESLEDMVSKSGKNVLLEFYAPWCGHCKKLAPILDEVAVR
FEKDPEVLIGKYDATANDVPTEFDVKYYPTLYFKTASGKLLSYDEDDRSKESLIAFIEKN
KDKAETKTENQESSKDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctctagagttttgctctgcttctctttgctcgtcgctctctgcttcaccgcg
atccacgccgacgaggctgattccaaggaattcgtcctcactctcgacagctccaacttc
tctgacactatcagcaagcacgacttcgtcgtcgtcgagttctacgccccatggtgtggc
cactgtaagaagctcgctccagagtatgaaaaagctgcatctatcttgagcagtctcgac
ccaccagtcattcttgcgaaagttgatgcaaatgaggaagcaaacaaaggacttgctact
gattatgatgttaagggtttccccacaatcaagattctaagagatggtgggaagattatc
caggaatacaagggtcctcgtgaagccgatggtattgtttcttatttaaagaaacaaagt
ggtcccgcttctgttgaactaaagagtgccgatgatgcaactactcttgttggtgaaaag
aagattgttgttgtcggtgtgtttgagaagttctctggagacgagtatgagaagttcttg
tctctagctcagaaattgcgttcagattatgaattcggtcacactcttgatgcaaagcac
ctaccccgtggtgattcatctgtgactgggccagtagttaggctgttcaagccattcgat
gaactttttgttgatttcaaggaattcaatgcagaggctctagagaagtttattgaagaa
tctagcttgccagttgttacagaattcaacaatgacccagacaaccacccttttgtgatc
aagttcttcaacggtcaaaatgataaggctatgttgtttctgaacttcagcagtgatgct
gctgatgcttttaaatcaaagtaccgtgaagttgctgagaaatacaaaggagaaggcata
agctttttagttggagatctagaggctagtcaaggtgccttccagtactttggacttaaa
gaagaccaggtgcctctgatcatcatacagaccaatgacggacaaaagtttttgaaacca
catttggagccagaccatatttctgtttgggtgagggaatacaaggatgggaaagtacca
gcatacaagaaatctgaacccatccctgagaagaacgatgagcctgtaaaagttatagtc
gctgagagcctggaggacatggtttccaagtctgggaaaaatgtgctgcttgagttttat
gccccatggtgcggacactgcaagaagcttgcaccaatcttggatgaagttgctgtgcgc
ttcgaaaaagatcctgaagttcttatcggaaaatatgatgctactgcaaatgatgtccca
actgagtttgatgtgaaatactatccaactttgtacttcaagacagcaagtggaaagcta
ttgtcctatgatgaggatgacagatccaaggaaagcctcattgctttcattgaaaagaat
aaggacaaagctgagactaaaactgagaaccaggagtcctcaaaagatgagctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system