KEGG   Fragaria vesca (woodland strawberry): 101309943Help
Entry
101309943         CDS       T02666                                 

Definition
4-alpha-glucanotransferase, chloroplastic/amyloplastic-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101309943
Enzymes [BR:fve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101309943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 573 aa AA seqDB search
MAVATSLSLLPSTLSPKLSSSSILFSSAHFQPRTRLPLFRVRNAAVSASSGYAVGEDLPL
DYGEVFPQADPSERRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHDAGFSLWQVLPLV
PPGRKANEEGSPYSGQDANCGNTLLISLDELVKDGLLTKEELPNPVDAERVNYAAVAEMK
DPLITKAAERLIMSEGDLKSQLEDFRRDPNISCWLEDAAYFAAIDSSLDAFSWYEWPEPL
KDRHLAALEDIYQRKEHFINLFIAEQFLFQRQWQRVRKYAQLKGISIMGDMPIYVGYHSA
DVWANRKHFLLNRKGYPLLVSGVPPDAFSETGQLWGSPLYDWKAMEKEGFSWWIRRIRRA
QNIYDAFRIDHFRGLAGFWAVPSEAKVAMVGKWKAGPGKSFFDAIFRAVGKTNIIAEDLG
VITEDVIQLRKSIGAPGMAVLQFGFGSDAANPHLPHNHERNQVVYTGTHDNDTIRGWWDV
LPQKEKSNVLKYLSIHEEEGISWAMIKGALSSVAQTAIMPMQDILRLGSSARMNIPATQF
GNWGWRMPSSVTFDSLETEALQLKDMLSMYGRL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgctacttctctctcactcctcccctccactctctcccccaagctctcctcc
tcctcgatcctcttctcctccgctcatttccaaccccgtaccagactcccgctcttccgg
gtgagaaacgccgccgtttctgcctcctccggttacgccgtcggcgaggacttgccgctc
gactacggcgaggtcttcccccaggcggatccgagcgagcgaagaagagccggcgtgctg
ctccatccgacgtcatttagaggacctcacggcattggcgatctcggcgaggaggcgttt
aggttcatcgactggcttcacgacgccgggttttcactctggcaggtcctcccgctcgtt
ccgccgggccggaaggcgaatgaggaaggctcgccgtactctggacaggatgcgaattgc
ggaaacactttgttgatatctcttgatgagcttgtcaaggatggtttgttgacaaaggaa
gaacttccgaatccggttgatgcggagcgtgtgaattacgcagccgttgctgaaatgaaa
gatcctttgataactaaggctgcagagaggcttattatgagtgaaggcgatctcaaaagt
cagcttgaagattttcgtcgagaccctaatatatcatgctggcttgaagacgctgcttac
tttgctgcaatcgacagcagtttagatgcttttagctggtacgagtggcctgaacccttg
aaagatcgtcatcttgcagccttagaagacatttatcagagaaaagagcattttataaat
ttattcatcgccgaacaatttttgttccaaagacaatggcagcgagttcgcaagtatgca
cagttgaaggggatcagtatcatgggagacatgcccatatatgtaggatatcatagtgca
gatgtttgggccaatagaaaacattttctgctgaacagaaaaggttatcctcttctagtt
agtggtgtcccccctgatgccttcagtgaaactggtcagctatggggcagccccctatat
gattggaaagcgatggagaaagagggattttcatggtggatacgccggataagaagagca
caaaatatatatgatgcattcagaatagaccacttcagaggacttgccggcttctgggct
gttccttctgaagcaaaagttgcaatggttggaaaatggaaggcagggcctggaaaatcc
ttttttgatgccatattcagagcagttgggaagaccaacataatagctgaagatttggga
gttatcaccgaagacgtaattcagctcaggaagtccattggggcacctggaatggccgtc
ctccaatttgggtttggaagtgatgccgctaatcctcatttacctcataatcatgagcgc
aatcaagttgtttatactggaactcatgataatgacacgattcgaggttggtgggatgtt
ttaccccaaaaagagaagtccaatgttctgaagtatctctcgattcatgaagaagaaggt
atctcatgggcgatgataaagggtgcattatcttctgtcgcccaaactgcaatcatgcct
atgcaagatattcttaggttaggaagttctgcgaggatgaatattcctgcaacacagttt
ggaaattggggttggaggatgcctagttctgtgacatttgatagcttggagacagaagct
ttgcaactgaaggacatgttgtcgatgtacgggcgcctgtaa

DBGET integrated database retrieval system