KEGG   Fragaria vesca (woodland strawberry): 101310742Help
Entry
101310742         CDS       T02666                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fve00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 358 aa AA seqDB search
MGAVVNSIDRDDRIPKEAKEILQSLATKWENVDDSTALQVIPLKGAMTNEVFQIKWPTST
GEVSCKVLVRIYGEGVEVFFDRDNEIRTFEYMSKNGQGPRLLGRFPNGRIEEFIHARTLS
ASDLRDPDISALIATKMKEFHDLEMPGPKDVVLWGRLRNWLSTAKKLCSPEEANEFRLDS
IEEEISILEKELSVPNQQMGFCHNDLQYGNIMIEEESKSITIIDYEYASYNPIAFDIANH
FCEMAADYHTDTPHILDYNKYPGIEERKRFVRVYLSSSGNQPSDNDLEQLVQEVEKYTLP
DHLFWGLWGIISEHVNDIDFDYLEYAKQRFQQYWRTKASLLGSVGSSPDTGTDGNCAL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgtggtgaattccatagatagagacgaccgtattccaaaagaagccaaggaa
attctacaatcattggctaccaagtgggaaaatgtagatgattcaactgcgctgcaggtg
atccctctcaaaggcgcaatgaccaacgaggtgttccagataaagtggccgacaagtact
ggggaagtctcatgcaaggttctggttaggatttacggtgagggtgttgaggtgttcttt
gacagggataatgagatccggacttttgaatacatgtcaaagaatggtcaggggcctcgt
ctgctcgggcgttttcctaatggccgaattgaagagttcatccatgcacggacactttca
gcatctgatctacgtgatccagatatatctgctcttatagctactaaaatgaaggagttc
catgatcttgagatgcctggtccaaaggatgttgtcctctggggcagattgagaaattgg
ctcagtacggccaagaaattgtgtagtccagaagaagctaatgaatttcggttagattcc
attgaagaagagatctctatactggaaaaggagctatcagtgcctaatcagcagatgggt
ttctgtcacaatgatttacagtatggtaatataatgattgaggaagagagtaaatcgata
acgataattgactatgagtatgcaagttataatcctattgcatttgacatagcaaaccat
ttctgtgagatggcagctgattatcacacagatacccctcatattttggactacaataaa
tatcctggcatagaggagcgcaaaaggtttgttcgtgtgtatctgagttcttcaggaaat
caacctagcgataatgacttagagcagctagttcaagaagttgagaagtatacccttcca
gatcatctgttctggggattatggggaataatatcggaacatgtgaatgatattgatttt
gactacttggaatatgcaaagcagaggtttcagcagtactggagaaccaaggcttcacta
ttgggttctgttggatcttcaccagacacagggactgatggtaactgtgctctttag

DBGET integrated database retrieval system