KEGG   Fragaria vesca (woodland strawberry): 101311110Help
Entry
101311110         CDS       T02666                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00052  Galactose metabolism
fve00500  Starch and sucrose metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101311110
   00500 Starch and sucrose metabolism
    101311110
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101311110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101311110
NCBI-ProteinID: XP_004303654
Position
LG6
AA seq 565 aa AA seqDB search
MIFSSSLWHFCILSLLLSYGVLQTSELTSAHHYRTGYHFQPRRNWMNDPNGPLIYKGIYH
LFYQYNPRGTGAGYRHIVWAHSTSTDLINWIPHNDAIYPSETFDINGCWSGSVTILPGGK
PAIFYTGVNSQNEQAQNLAFPRNLSDPFLKEWVKIPQNPLISATPANHINASSFRDPSTA
WLGPDHRWRLIVGSRKGKTGLAILYRSRDFLKWTKAKHPLHSTKENGMWECPDFFPVSKT
KLLGLDTSATGPNVKHVFKVSLDNTKKEYYTTGTYNVEKDIYIPDKGSVESDNSGLRYDY
GKFYASKTFFDSAKNRRILWGWINESSSVKGDINKGWSGLQAVPRTVLLDKSGKELVQWP
IVELEKLRTKHVKLPNIVLKEGSLHRVLGVTPAQAVVEITFEISDLKKAEVFDPSWTDPQ
TLCSKKGASVKGGLGPFGLLVLASKGLKENTAVFYRIFKSQNNKYKYVVLMCSDQSRSSL
NQDNDMITYGTFVNVDPVHEKLSLRSLIDHSIVESFGGLGKACITARVYPKLTVDGDTRL
YIFNYGNESVEITGDVWSMKTAKMN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatattctcctcatctctttggcatttctgcattctttctcttttgctctcttatggt
gttcttcagacttccgaactgacttcagcacatcattaccgaactggctatcatttccag
ccccgaaggaactggatgaatgatccaaatgggccactgatttacaagggaatttaccat
cttttctatcaatacaatcccaggggtaccggtgcaggttatcgccatattgtttgggca
cattctacatcaactgatcttattaattggatcccgcataatgatgctatttacccatca
gagacgtttgatatcaatggttgttggtcggggtcagttacaatccttcccggcggtaag
ccggccattttttataccggagtcaactcccaaaacgagcaagctcaaaacttggccttc
cccagaaacctctcagacccattccttaaggaatgggttaagatcccacaaaacccgtta
attagcgcaaccccagctaatcatataaatgcatcctcatttagggacccaagtactgct
tggttaggacccgatcatagatggagattaatcgttggtagccgaaagggcaaaacaggc
ttagctatcttatatagaagcagagatttcctcaaatggaccaaggcaaagcatccactt
cattccacaaaggaaaatggaatgtgggaatgccctgattttttcccagtgtcaaagact
aagttgctcggtcttgacacatctgcaactggtccgaatgttaagcatgtgttcaaagta
agcttggacaatactaagaaagagtactacacaactgggacatataatgtggaaaaggat
atctatatcccagataagggatctgttgagagtgataattctggcttgagatatgattat
gggaagttttatgcttcaaaaaccttttttgacagtgcaaagaaccgcagaatcttgtgg
ggttggatcaatgagtcctcaagtgttaaaggtgacatcaacaaaggatggtctggactc
caggcagttccaaggaccgttttgcttgataagtctggaaaagaattggtgcaatggccc
attgtagaacttgaaaagttgagaacgaagcatgtcaagttgcccaacattgtgctcaag
gaaggatcactccatagagtactcggtgttacaccagcacaagctgttgtagaaatcaca
tttgagattagtgatttgaagaaagcagaagtgtttgatccaagttggactgatcctcaa
actttgtgtagtaaaaaaggtgcttcagttaaaggtggtcttggaccatttggtttactg
gttttggcttcaaagggattgaaagaaaatacagcagtattctataggatattcaaatct
cagaacaacaagtacaaatatgtagtgctcatgtgtagcgaccaaagcaggtcgtccttg
aatcaagataatgatatgatcacatatgggacttttgtaaatgtggatccagttcatgaa
aagctatccctaagaagcttaatcgatcattcgatagtggaaagttttggaggactaggc
aaggcatgtataactgcaagagtttatcctaaattgactgttgatggtgatacccgatta
tatattttcaattatggaaatgagagtgtcgaaattacaggagatgtatggagcatgaaa
actgctaaaatgaattga

DBGET integrated database retrieval system