KEGG   Fragaria vesca (woodland strawberry): 101311837Help
Entry
101311837         CDS       T02666                                 

Definition
(RefSeq) phosphoinositide phospholipase C 4-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101311837
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    101311837
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101311837
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101311837
Membrane trafficking [BR:fve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101311837
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101311837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG3
AA seq 588 aa AA seqDB search
MGSYRMCVCFTRKFRITEAEPPSDVTEYFAKYAEGGTHMTAEQLRNFLEDVQGYGGASIS
EAEQIVEQMLQKRHHHIAKLITRRTLTLEDFHHYLFSADLNPPIENQVHQDMNAPLSHYY
IYTGHNSYLTGNQLSSDCSHVPIIKALKRGVRVVELDLWPNSAKDDVNVLHGRTLTTPVE
LVKCLKSIKEHAFTESPYPVVITLEDHLTPDLQAKVAKLLMKTFKEMLFIPDSECFKKLP
SPEDLKYRIIISTKPPKEYLEDKSVNDKEDNLHKRKDSEEDEWGNEPAEPKEEHEDVGTS
ESEASELNQDCEDNNNSSHGAEPASYKRLIAIHAGKPSGGLKEALKVEVDRVRRLSLSEQ
ALEKAAECHGTDVVRFTQKNILRVYPKGTRFNSSNYKPLIGWMHGAQMVAFNMQGYGKSL
WLMHGMFRANGGCGYVKKPDFVMNDEQIFDPKAKLTVKKTLKVKVYMGDGWHLDFKQTHF
DLYSPPDFYTRVGIAGVPADEVMKKTKKKEDDWTPVWEEEFTFPLRVPELALLRIEVHEY
DMSEKDDFGGQTCLPISELKQGIHALPLFNRKGEKYNSVRLLMRFEFT
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggggagttaccggatgtgcgtgtgcttcactcgcaagttcaggatcacagaggctgag
ccaccttccgacgtgacggaatacttcgctaagtacgccgagggagggacccacatgacc
gccgagcagctcaggaactttctggaggatgttcagggctacggcggcgcgtcgatctcg
gaggccgagcagatcgtggagcagatgctgcagaagaggcaccaccacattgccaagttg
ataacgaggcgcacgctcactctggaagacttccaccattacttgttctctgctgatctc
aaccctccaatagagaaccaggttcatcaggatatgaatgctccattgtctcattactac
atatatactggacacaattcatatttgactggaaatcaactcagtagtgactgcagtcat
gttccaatcatcaaggcactgaagagaggtgtgagagtggtggagcttgatctttggcca
aattcggcaaaggatgatgtcaatgttcttcatggaaggaccttgacaactcctgtggaa
cttgttaagtgcttgaagtcaattaaagagcatgcttttactgaatctccatatcctgtt
gtcataactcttgaagatcaccttacccctgatctccaagctaaagtagcaaagctgctc
atgaagacatttaaggaaatgttgtttattcctgattctgaatgtttcaaaaaattacct
tcaccagaagatctgaagtatcgaataatcatatctaccaaacctcctaaagagtacctt
gaggataaaagtgtcaatgacaaggaagataacttgcacaagagaaaagatagcgaagaa
gatgaatgggggaatgaacctgcagagcctaaagaggaacacgaagatgttggtacaagt
gaaagtgaagcaagtgaactaaatcaggattgcgaggataacaataactccagtcatgga
gcagaacctgcatcatacaaacgcctaattgcgatccatgctgggaaaccaagtggtggt
ttaaaggaggcacttaaagttgaggttgatcgagtcagacgccttagtttgagtgaacaa
gcacttgaaaaggctgctgaatgtcatggaactgatgttgttaggttcacccagaagaac
attttaagggtctatccaaaaggaactcggttcaactcctccaactataagccgcttatt
ggttggatgcatggtgctcagatggttgcatttaatatgcagggatatggtaaatctctt
tggctgatgcatgggatgtttagagcaaatgggggatgtggttatgtaaaaaagcctgat
tttgtcatgaatgatgagcagattttcgatcctaaagcaaaattgactgtaaagaagact
ttaaaggtgaaagtgtatatgggagatggttggcatttggatttcaaacaaacacacttt
gatttatattcaccacctgatttttacaccagggtcggcatagcaggagttccagctgat
gaggtaatgaagaaaactaagaaaaaagaggatgattggactcctgtatgggaagaagag
tttacatttccgctgagagtccccgagttggctctgcttagaatcgaggtacatgaatat
gacatgtctgagaaagatgactttggtggccaaacttgtctgccaatctctgaattgaaa
caaggaattcatgcactcccactctttaaccgaaaaggagaaaaatacaactcagtgagg
cttctaatgcgatttgagttcacctga

DBGET integrated database retrieval system