KEGG   Fragaria vesca (woodland strawberry): 101311870Help
Entry
101311870         CDS       T02666                                 

Definition
(RefSeq) histone deacetylase 15
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101311870
Protein phosphatases and associated proteins [BR:fve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101311870
Messenger RNA biogenesis [BR:fve03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101311870
Chromosome [BR:fve03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101311870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG5
AA seq 571 aa AA seqDB search
MIVAENPNASTEQNLVSETLQMTRLANGEAEVSRHKSNNEVSGKDASTDDVNGITPPEVS
SKKAGQQKEMTFQDVYNQDLDDEEDDSDWEPLQRSAELVKWFCTNCTMVNLGDDVNCDIC
GEHRESGILRHGFLASPLLPDSGLTEIDSDIRERHKGSRDSASNSSTAVGFDERMLLHSE
IQMQSHPHPERPDRIRAIAASLATAGIFPGRCYPIPAREITREELQMVHSLEHVEAVDLT
GHMFSSYFTPDTYANEHSACAARLAAGLCADLASAIVSGRTKNGFALVRPPGHHAGIKQA
MGFCLHNNAAVAALAAQVSGAKKVLIVDWDVHHGNGTQEIFDQNKSVLYISLHRHEGGKF
YPGTGAADEVGTMGAEGYCVNVPWSRGGVGDNDYIFAFQNVVLPIASAFAPDITIISAGF
DAARGDPLGCCDVTPAGYAKMTDMLTDLSGGKLLVILEGGYNLRSISSSATSVIKVLLGE
SPGCEFDNASPSRSGLQTVLEVLKIQSKYWPVLASNFTKLQSQERMHSIENKRKQIEKKR
RAVAPMWWKWGRKGLLYHFLNRHVQMKRKGV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgattgtggctgaaaatcccaatgcaagtactgaacagaacttagtatcggaaactctt
caaatgactcgtttagctaatggggaggcggaggtaagtcgtcacaaatcgaacaatgaa
gtctccggcaaagatgcatcaacagatgatgtaaatgggatcacgccgcctgaggtttct
agtaaaaaggcaggacagcaaaaagaaatgactttccaagatgtgtacaaccaagacctc
gatgatgaggaggatgacagtgattgggagcccctgcaaaggagtgctgaacttgtgaag
tggttctgcaccaactgcacaatggtcaaccttggtgatgatgtcaattgcgatatatgt
ggggaacatagagagtctggaattcttaggcatggttttttggcatctcccctgttacca
gattcaggcttgactgagattgattctgatattagagaaagacataaagggtcacgagat
tcagcctcaaacagttccactgctgtgggttttgatgagagaatgttgctacattcagaa
attcaaatgcagtcacatccacacccagaaagaccggatcgtattcgagctattgctgct
agccttgctacagctggtatatttccaggacgatgttacccaattcctgctagagaaatt
acgcgtgaagaactgcagatggtccattccttagagcatgttgaagctgttgatcttaca
ggccatatgttctccagttatttcactcctgacacatatgccaatgaacattcagcatgc
gctgctaggcttgcagcaggtttatgtgctgatcttgcttcagcgattgtttctggacgt
accaagaatggttttgctttggttcgacctcctggtcatcatgctggtataaagcaggca
atggggttttgcctccacaataatgcagcagttgctgcattagcagctcaagtttctggg
gctaaaaaagttctgattgttgattgggatgttcatcatgggaacggcacccaagaaata
tttgaccagaacaaatcggtcttgtatatatctttgcatagacatgagggggggaagttc
tatcctggtactggagctgctgatgaggttggtactatgggagctgaaggatactgtgtg
aatgttccatggagtcgtggtggagtgggtgataatgattatattttcgcatttcagaat
gttgtgcttcctatagcttctgcatttgctcctgacatcaccatcatatcagcaggattt
gatgcagcaaggggtgatcctctaggatgttgtgatgttactcctgctggctatgcaaag
atgactgacatgttgactgatttgtctggagggaagttgttggtcattcttgagggcggg
tataatctacggtcaatatcatcttctgctacttcagtaattaaggtattactgggtgaa
agtccaggatgtgaattcgacaatgcttcaccttccagatctggactgcaaactgttcta
gaggtccttaaaattcaaagcaagtactggcctgttttggcgtccaactttacaaaattg
cagtcacaagagagaatgcactctattgaaaacaaaaggaaacaaatagaaaagaaacgg
cgggctgtggctccaatgtggtggaaatggggacggaaaggtctactgtatcattttcta
aatcgccatgtccaaatgaagcgaaagggtgtttga

DBGET integrated database retrieval system