KEGG   Fragaria vesca (woodland strawberry): 101311924Help
Entry
101311924         CDS       T02666                                 

Definition
histone deacetylase 19-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fve  Fragaria vesca (woodland strawberry)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 495 aa AA seqDB search
MDTGGNSLASGPDGVKRKVSYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQHMQ
VLKPYPARDRDLCRFHADDYVAFLRNITPESQQDQLRQLKRFNVGEDCPVFDGLYSFCQT
YAGGSVGGAVKLNHGICDISINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLY
VDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGYGKGKYYSLNVPLDDGI
DDESYHYLFKPLIGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKYMRSFN
VPLLLLGGGGYTIRNVARCWCYETGVALGAEIEDKMPQHEYYEYFGPDYTLHVAPSNMEN
KNSHQLLEEIRSKLLENLSRLQHAPSVQFHERPPENEIPEEDEDQEDRDERWDADSDMEL
DNERKPLPPSRVKKEIVEPEVKDPKGAAENSRAYDDAGLDEITTSAKALDMGSGSMEEPS
VKVEQESLNKPADQM
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggacaccggcggcaactcgctggcgtcaggccccgacggcgtgaagcgcaaagtgagt
tacttctacgacccagaagtcggaaattactattatggacaaggccacccgatgaagccc
caccgcatcagaatgacccacgccctcttagcccactatggtcttctccagcacatgcag
gttctcaaaccctacccggcccgggaccgagacctctgccgcttccacgccgacgattac
gtggcgtttctccggaatattacccctgaatcgcagcaggaccagcttaggcagttgaag
aggtttaatgttggggaggattgtcctgttttcgatgggttgtattcgttttgtcagact
tatgccggtgggtctgttggtggggctgtcaagctcaaccatgggatttgtgacatttcg
attaattgggctggtgggttgcatcatgctaagaagtgtgaggcttccgggttttgttat
gtcaatgacattgtgcttgcaatcttggagcttcttaaacaacatgagagagttttgtat
gtggacattgatatccaccacggagacggtgttgaggaggcgttttacacaacagacagg
gtcatgacggtttcgtttcataaatttggagactatttcccggggacgggggatattcgc
gatattgggtacggaaaaggaaagtattactcactgaatgttccgttggatgatgggatt
gatgacgagagctaccattacttgttcaaacccctgattgggaaggttatggagattttt
aggcctggtgctgttgttctacagtgtggcgctgattccttatctggggataggcttggt
tgctttaatctttcaatcaagggtcatgctgaatgtgttaaatacatgagatccttcaat
gtccccctcttgcttctagggggtggtggctatactatccgtaatgttgctcgttgctgg
tgctacgagacaggggttgctcttggagcagaaattgaggacaaaatgccacaacatgag
tattacgagtattttggtccagactatactcttcatgttgcccctagtaacatggaaaac
aagaattctcatcagttgctggaagaaatacgatcaaaacttcttgagaacctctccagg
cttcagcatgcacctagtgtccaatttcatgaaaggcctcctgaaaatgagattccagag
gaagatgaggatcaggaggacagagatgagagatgggatgccgattcggacatggagctt
gataacgaacgaaaacctttaccaccaagcagagtaaagaaagaaattgttgaacctgag
gttaaagacccgaaaggagccgcggagaactctcgagcctatgatgatgctggactggat
gagattacaacaagcgcaaaggctttggatatgggctctgggtctatggaagaaccaagt
gtgaaagtggaacaagagtctctaaataagcctgcggatcagatgtaa

DBGET integrated database retrieval system