KEGG   Fragaria vesca (woodland strawberry): 101312918Help
Entry
101312918         CDS       T02666                                 

Definition
beta-amylase 1, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fve00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 578 aa AA seqDB search
MAFSITHQIGALAGTPISVTEPNKSSGESTASVTASAVRKSPAAGLTCKIQNPEGKETGM
LTPPMSPCRSPVLGATRPDLSVACQAYATEVEAAPVLEHELRGHVEKINGVPVFVMMPLD
SVTMNHTVNRKKAMNASLQALKSAGVEGIMMDVWWGLVERDAPGAYNWGGYNELLEMAKK
HGLKVQAVMSFHQCGGNVGDSCTIPLPNWVVEEVNNDPDLAYTDQWGKRNYEYLSLGVDT
LPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEVQVGMGPAGELRYPSYPEGDGTWSFP
GIGAFQCFDKYMLSSLKAYCESEGKPEWGSTGPTDAGHYNNWPEDTPFFRKEGGGWNSTY
GEFFLGWYSQMLLDHGERILSSAKAIYENEGVKISVKVAGIHWHYGTRSHAPELTAGYYN
TRFRDGYLPIAQMFARHGAIFNFTCIEMHDHEQPQDAQCSPEGLVRQVALATQKAGVPLA
GENALPRYDDYAHEQILQASALNIKGNTEGKQMCAFTYLRMNPQLFQADNWRRFVSFVKK
MKEGKNTHKCREEVEREAEHFVHVTTPLVQEAAVALMH
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcagcatcacacaccagatcggagcgctcgccgggacgccgatatcggtgacg
gagccgaacaagtcgtccggcgaatcaacggcgagcgtgaccgcatccgcggtgcggaag
tcaccggcggcgggtctcacgtgcaagattcagaatccggaggggaaggaaaccgggatg
ttgaccccgccgatgagcccgtgccgctcgcctgttctcggcgcgaccaggccggatctg
tcggtggcgtgccaggcgtacgcgacggaggtggaggcggcgccggtattggaacacgag
cttagaggccacgtggagaagataaacggcgtgccggttttcgtgatgatgccgttggac
agcgtcacgatgaaccacacggtgaatcggaagaaggcgatgaacgcgagtcttcaggcg
ctgaagagcgccggggtggaggggatcatgatggacgtgtggtgggggttggtagagagg
gacgcgcccggcgcgtacaattggggcgggtacaacgagctgttggagatggccaagaag
cacgggcttaaggtccaggccgtcatgtcgttccaccaatgcggcggtaacgtcggtgac
tcttgcactattcctttaccgaattgggttgtggaggaggttaacaacgatccagacctt
gcatacactgatcaatggggaaagagaaactacgagtatctttcacttggcgttgataca
cttccagttcttaaaggccgcacgccagtgcaatgttatgctgacttcatgcgtgccttc
agagacaacttcaagcaccttcttggtgacaccatcgtggaagtacaagttggaatgggt
ccagcaggtgagcttcgctacccttcatatccagagggggacgggacatggtcattccct
ggaattggtgccttccaatgttttgacaagtatatgctcagtagcttaaaagcttattgt
gaatctgagggtaagccagaatggggtagcacaggccccactgatgctggtcactacaat
aactggcccgaagataccccattcttcagaaaagaaggtggaggctggaatagtacttat
ggtgaattcttccttggctggtactcccagatgctcctggaccatggtgagaggatcctt
tcctcagccaaggctatctatgagaatgagggcgtgaaaatctcagtgaaggttgcaggc
atccattggcattatggaacccggtctcatgcccctgagctcacagcagggtactacaac
acacgattccgcgatggttacctaccgattgctcagatgtttgcccgccatggtgccatt
ttcaatttcacttgcatcgagatgcacgaccatgagcagccacaggacgcccaatgttcc
cctgaagggcttgttaggcaagtcgccttggccacccagaaagcaggagtaccgctagca
ggtgaaaatgcactgccaaggtatgatgactatgcacacgagcaaatcttgcaagcatca
gcattgaacattaagggcaatactgaaggcaagcagatgtgcgcgttcacatacctgagg
atgaacccgcaactattccaggctgacaactggaggcgttttgtgtcatttgtgaagaaa
atgaaggaaggaaagaacactcacaagtgtagggaagaggtggagagggaagccgagcat
ttcgtgcacgtaacaacacctctggtacaggaggctgctgtcgctttgatgcactag

DBGET integrated database retrieval system