KEGG   Fragaria vesca (woodland strawberry): 101313025Help
Entry
101313025         CDS       T02666                                 

Definition
probable MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101313025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 445 aa AA seqDB search
MGSIGTSPVPENGSDTPNGATVTYDGDTKPHTGDGYPPSAAVTTPESEASKKRRMSLLPL
EVGTSVLCRWRDNKYHGVKVIERRRVHGGGPNDYEYYVHYTEFNRRLDEWVKLDQLDLDS
VEAVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
RYEIETWYFSPFPPEYNDSGKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRNHT
LSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKE
KHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYW
TRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGPAGLEVDVGKLIWTPYKEQG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgataggcacatctccggttcccgaaaacggctctgatacccccaacggcgcc
accgtcacatacgacggcgacaccaagcctcacaccggcgatggatatcctccctccgcc
gccgtgacgacgccggaatcggaagcgtcgaagaagcggaggatgtccctgcttcctttg
gaggtcggcacgagcgtcctgtgtcgttggagggacaacaagtaccatggagtcaaggtc
atcgagcgccggagggttcacggcggcggacccaacgattacgagtattacgttcactat
accgagttcaataggaggcttgatgagtgggtgaaacttgatcaacttgaccttgattca
gtagaggctgttgttgatgagaaagtggaggacaaggtcacaagcttgaaaatgactcgc
catcagaagcgtaagattgatgagacccatgtggaggggcatgaggaacttgatgctgct
agcttacgtgaacatgaagaatttactaaagtgaaaaatatagcgactatagaacttgga
agatatgagattgagacatggtacttctcgccgtttccaccagaatataatgactcgggg
aagctgtacttctgtgagttttgtctcaatttcatgaagcgtaaagaacagcttcagagg
catatgaggaagtgtgatcttaagcatcctcctggtgatgagatataccggaatcatacg
ctttctatgtttgaggttgatggtaaaaagaacaaggtttatggacagaacctttgttat
ttagcaaagctgtttcttgatcacaagaccctgtactatgatgttgacctctttctattt
tacattctatgtgaatgtgatgatcggggatgccatatggttggatatttttcaaaggaa
aaacattcggaggagtcctataacttggcatgtatccttacccttcctccttatcaaaga
aaaggctatggaaaatttctaattgccttttcatatgaactatcaaagaaagaaggtaaa
gttggtacgcccgaaagacccctctctgacctaggactattaagctacagaggatactgg
acccgggtgcttctagatatcttgaagaagcataagggaaatatttccatcaaggagctc
agtgacatgactgccatcaaggcagaggatattttgaccactcttcagagtctagaatta
attcagtacaggaaagggcagcatgtcatctgtgctgatccaaaggtcttggaccgtcac
ttaaaagcagctggtcctgctggtctggaggttgatgttggcaaattgatctggacgccg
tataaagagcaaggctga

DBGET integrated database retrieval system