KEGG   Fragaria vesca (woodland strawberry): 101313085Help
Entry
101313085         CDS       T02666                                 

Definition
probable pectinesterase/pectinesterase inhibitor 41-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101313085
   00500 Starch and sucrose metabolism
    101313085
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101313085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 560 aa AA seqDB search
MASSKVLATASFLIFLSLFASLSLAANTTDPTTPVSSGTICKSTPDPSYCKSVLSNQTSS
TVYDFGRFSVRKSLSQARKFLNLVDNYLKKGSSLSVPAVRALEDCRFLAGLNMDLLSNSF
QTVDKTSRLLSTLKADDVQTFLSAILTNQQTCLDGIQAVASSWGLKNGLAVPLRNDTKLY
SVSLALFTKGWVPKNKKGSGGRTGRKSGFKNGRLPMKMSSKSRKVYEAASRRKLEEDDGV
LVSEVVTVRQDGSGDYTTITDAIAATPNNSAAANGYFMIYVTAGVYEEYVSIAKNKRYLM
MVGDGINQTILTGNRSVVDGWTTFNSATLAVVAPGFVAVNMTFRNTAGAAKHQAVAVRNG
ADLSTFYSCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGNAAVVLQNCNIYPRLPMTG
QFNAITAQGRTDPNQNTGTSIHNCTIRAADDLASSNGTTQTYLGRPWKEYSRTVYMQSNI
DSVVNSAGWRAWDGEFALSTLYYAEYNNTGAGSDTTNRVTWAGYHVITNSSDASNFTVSN
FLLGEDWLPQTGVPYTGGLL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctaaggtactagctacagcttcatttctcatctttctttctctctttgcc
tccctatctcttgctgctaacaccaccgatccaacaactcctgtatcttcagggacaata
tgcaagagtaccccggacccttcttactgtaagtccgtcctttctaaccaaacatcctca
accgtctatgatttcggacgattctccgttcggaaatccctgtcccaagcccggaagttt
ctaaacttagtcgacaactacctcaaaaaagggtcctccttgtccgtccccgccgtccga
gccctcgaggactgtcgcttccttgcagggctcaacatggacttattgtccaactcgttt
caaaccgtcgacaaaaccagccgccttctttctactctcaaagccgacgacgttcagacc
tttctgagtgctattctaacaaaccaacagacgtgcttggacggcatacaagccgtggct
tcgtcttggggattgaagaacgggctcgccgttccgctccgcaacgacaccaagctctac
agtgtctccctcgcgctcttcaccaagggatgggtccccaagaacaaaaaagggagtgga
gggaggacagggaggaagagcgggttcaaaaacggaaggttgccgatgaaaatgtcaagc
aaatcgcgaaaggtttatgaggcagcgagccggaggaagttggaggaggatgatggcgtg
ttggtgagtgaggtggtgacggtgaggcaggatggtagcggcgactatactactattact
gacgccattgccgcgactccgaataactctgccgcggcgaatggctacttcatgatctat
gtgacggccggtgtttatgaggagtatgtgtctattgcaaagaacaagaggtatttgatg
atggttggagatgggatcaaccagacgattctcaccggtaataggagcgttgttgatgga
tggacaactttcaactctgcaacacttgctgtggttgcacccggatttgtagccgtaaac
atgacattccgcaacacagccggagctgccaagcaccaagcagtcgcagtccgaaacggc
gcagacctatccacattctacagttgcagcttcgaggcgtatcaagacaccttatacaca
cattccctaaggcaattctaccgagaatgtgacatctacggaacggtggatttcatcttt
ggaaatgcagcagttgttctccaaaactgcaacatataccctcggcttcccatgaccggc
cagttcaatgccatcaccgctcagggacgaaccgacccgaatcagaacaccggcacttcg
atccacaattgcactatccgagccgccgatgacttggcttcgagcaatggcactacacag
acatatcttggaaggccatggaaggagtattctagaacagtttacatgcagtctaacatt
gacagtgtggtgaactcagctgggtggagagcttgggatggagagtttgctcttagcaca
ttgtattatgcagagtacaataacacaggggctggatcggacaccacaaacagggttacg
tgggcaggataccatgtcattaccaactccagtgatgcttctaattttactgtgtcgaat
ttcttgctgggagaggattggttgcctcaaacaggggtgccttacaccggtggcttactt
tga

DBGET integrated database retrieval system