KEGG   Fragaria vesca (woodland strawberry): 101313328Help
Entry
101313328         CDS       T02666                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101313328
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101313328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 559 aa AA seqDB search
MVESKTVHSPLVTYASMLSLLTLCPPFVILLWYTMVHADGSLLQTWEYLRQNGLQGFIDI
WPRPTAIAWKIIACYGAFEAALQLLLPGKRVEGPISPAGNRPVYKANGMAAYFVTLTTYI
GLWWFGIFNPTIVYDHLGEIFSALIFGSLVFCVLLYIKGHLVPSSTDSGSSGNVIIDFYW
GMELYPRIGEHFDIKVFTNCRFGMMSWAVLAVTYCIKQYELNGRVADSMLVNTILMLVYV
TKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYLVNHPINLGSQLALLIL
VAGILCIYINYDCDRQRQEFRRTNGKCLVWGRAPSKIVASYTTQSGETKTSLLLTSGWWG
LSRHFHYVPEISAAFFWTVPALFNHFLPYFYVVFLTILLLDRAKRDDDRCRSKYGKYWKL
YCQKMSAYENVVGGKLKLKGKALDVKAAGIKKKKKHKKHQEQISLVNQKELAAGGSTEEL
TNPDEEDMNDDNRSREDGKGSYDEYLTPAERRYIEQREQIDNHKLAKTANKSHRDRIQDF
NQYLANMSEHYDIPKVGPG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagcaagactgtgcactcaccattggtgacttacgcttccatgctttcactg
cttacactctgccctccatttgtgattctactatggtatacaatggtacatgctgatggc
tctcttttacaaacttgggagtacttgagacaaaatgggctgcaggggtttatagacata
tggccaagacctactgctattgcctggaaaatcattgcatgttatggcgcttttgaggct
gcacttcagctgcttttacctggaaaaagggtcgagggaccaatatctccggctgggaat
cggcctgtgtacaaggcaaatggtatggcagcatactttgtgacattgactacatatatt
ggcctttggtggtttgggatattcaaccctacaattgtttatgatcatttgggagaaata
ttttcggccctcatttttggaagtttggtgttttgtgttctcctatacataaaaggtcac
ttggtgccatcttccacagattctggctcttctgggaatgttataattgatttttactgg
ggcatggaactgtatcctcgaattggtgaacactttgatatcaaagttttcacgaactgt
agatttggaatgatgtcctgggccgttcttgcagtgacctattgcataaagcagtatgag
ttgaatgggagagtagctgattcaatgctcgtaaatactatactgatgctggtgtatgtc
acaaaattcttctggtgggaggctggatactggaatacaatggatattgcacatgatcga
gcgggattttatatttgctggggttgtttggtgtgggttccatctatttatacctcacct
ggcatgtacttggtcaaccatcctataaatctcggcagtcagctagcacttcttattttg
gttgcggggattctctgcatatacatcaactatgattgcgacaggcaaagacaagaattt
cgcagaacaaatggcaaatgtttagtctgggggagagctccatcaaagatagttgcttca
tacactacacaatctggggaaacaaagacaagtcttctcttaacctcaggatggtggggt
ttatctcgccatttccattatgtgccagaaatatcagctgcctttttctggactgttcca
gctcttttcaatcattttctaccgtacttctatgtggtgtttcttacaatccttctatta
gaccgagcaaaaagggatgatgatcgatgtcgatccaagtacgggaaatactggaaatta
tattgtcagaaaatgtcggcatacgagaatgttgttggtgggaagctcaagcttaagggg
aaggctctggatgtgaaggctgctggaattaagaagaagaagaaacataagaaacatcag
gagcaaatatctcttgtcaaccagaaggagcttgcagctggtggaagtacagaagagttg
accaatcctgatgaggaagatatgaatgatgacaacagatcaagagaggatgggaagggt
agttatgatgagtatctcacacctgcagagaggcgatatatagaacagagagagcaaatt
gataatcacaagttggccaaaacggctaataaatcacaccgtgacagaattcaagatttc
aaccagtacctggcaaacatgagtgagcattatgacattcctaaagttgggccaggctaa

DBGET integrated database retrieval system