KEGG   Fragaria vesca (woodland strawberry): 101313449Help
Entry
101313449         CDS       T02666                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK2
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG7
AA seq 373 aa AA seqDB search
MESSSASGADHNIRGVPTHGGRYVQYNVYGNLFEVSRKYVPPIRPVGRGAYGIVCAAVNA
ETHEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENVIAIKDIIRPPQKENFNDVYIV
YELMDTDLHQIVRSNQSLTDDHCRYFLYQLLRGLKYVHSAGVLHRDLKPSNLLMNANCDL
KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRRPL
FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYAKKDFSVGFPNMSAGAI
DLLEKMLVFDPNRRITVDQALCHPYLAPLHDINEEPVCASPFSFDFEQPSFTEENIKELI
WRESVKFNPDPIQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggagtccagctctgcttctggagctgaccacaacatcagaggggtaccaacccacggt
ggccggtacgttcagtacaatgtgtatgggaatctctttgaggtttccaggaagtatgtg
cctcctatcaggccagttgggagaggcgcctatggtattgtttgtgctgctgtgaacgct
gagactcatgaggaggttgccattaagaagattggtaatgcatttgacaacagaatagat
gccaaaaggactttacgcgaaattaaacttcttcgtcacatggatcatgaaaatgttatt
gccatcaaagacatcataaggcctccacagaaggagaacttcaatgatgtctacattgtt
tatgaattaatggacactgaccttcatcagatagtacggtccaaccaatctttgactgat
gaccattgccggtactttctgtatcagttgttacgagggctcaaatatgtacattcagca
ggtgttttacatcgtgatttgaagcccagcaatttgctcatgaatgcaaattgtgatctc
aaaattggtgattttgggcttgcaaggacaacatctgaaactgatttcatgaccgagtat
gttgttactcgttggtaccgcgctccggagttgctccttaattgttccgagtacactgca
gcaattgatatatggtctgtaggttgcattcttggtgaaatcatgaccagacggccctta
ttccctggcaaagattatgtgcatcagctgagactcattacagagctaataggttcacct
gatgactcaagcctcggatttttacgaagtgataatgcccgaagatatgtccgacaacta
cctcagtacgcaaagaaggacttctctgttggatttcctaatatgtctgctggtgctatt
gatttgctagagaagatgcttgtctttgacccaaacaggcgcattacagttgatcaggct
ctttgccacccatacttggcacctcttcatgatattaatgaggagcctgtctgcgcaagt
cctttcagttttgacttcgagcaaccatcatttacagaagagaacatcaaggagctcatc
tggagagagtcggtcaagttcaatccagatccaattcagtga

DBGET integrated database retrieval system