KEGG   Fragaria vesca (woodland strawberry): 101314433Help
Entry
101314433         CDS       T02666                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog NTF3
  KO
K20535  
mitogen-activated protein kinase 1/2 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    101314433
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101314433
Protein kinases [BR:fve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101314433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG2
AA seq 372 aa AA seqDB search
MATPVAPPNGVRSEGKHYFSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKINNAFENRIDALRTLRELKLLQHLRHENVISLKDVMMPIQRNSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTRKGKDQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIINILGSQREEDIEFIDNPKAKKYIKSLPYSPGTPFSCLYPDAHPLAIDLLQKML
VFDPSKRIGVTEALQHPYMSQLYDPNGNPPAEVPIDLDIDEDLGEEMIREMMWSEMLLYH
PEAVASNGQVYS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccggtggcgcctccgaatggtgtgagatcagaagggaagcattacttttca
atgtggcagacgttgtttgagattgacacgaaatacgtgccgattaagccgattgggaga
ggagcctacggcatcgtgtgctcttctgtgaacagagagaccaacgagaaagtggcgatc
aagaagatcaacaatgcgttcgagaatcgtatcgatgcgttacggactttgagagaattg
aagctgctgcagcatcttcggcacgagaatgtgatttctctgaaagatgtgatgatgccg
attcagaggaatagtttcaaggatgtgtatttggtgtatgagctcatggatacggatctt
catcagattattaaatcttcgcagcctctttcgaatgatcattgccagtatttcctgttt
cagctgcttcgaggcctaaagtatctccattctgcaaacattctccatcgtgatttgaag
cctggcaatcttcttatcaacgcaaactgtgaccttaaaatatgtgattttgggctagca
cgtacaagaaaagggaaagaccagttcatgactgagtatgttgtcactcgttggtatagg
gctccagagctactcctgtgctgcgataactatggaacttccattgatgtatggtctgtt
gggtgcatctttgctgagcttcttggccggaagcctatcttccctggcacagaatgtctc
aaccaacttaaacttataattaacatccttggcagccagagggaggaggatattgaattt
atagacaatccaaaggcgaagaagtacatcaagtcactgccatattctcctgggacgccc
ttctcctgtctttaccccgatgcccatcctttggccatcgatctactacagaagatgctt
gtttttgacccatcaaagaggatcggtgtcactgaagcactccaacacccttacatgtcc
caattgtatgatccgaatggtaaccctcccgctgaggtaccaattgatcttgacatagac
gaggacttgggagaagagatgataagggagatgatgtggagtgaaatgcttctataccat
cctgaagctgttgcaagcaacggtcaagtgtattcctaa

DBGET integrated database retrieval system