KEGG   Fragaria vesca (woodland strawberry): 101314495Help
Entry
101314495         CDS       T02666                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101314495
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101314495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 280 aa AA seqDB search
MNPMDFIESLDPQILVGVSVAFVVIVAAAFLFSSKKPKGCLDPQNFKDFKLVKRTQLSHN
VAKFKFELLTSTSILGLPIGQHISCRGKDSQGEEVIKPYTPTTLDSDVGYFELVIKMYPQ
GRMSHHFREMRVGDHLAVKGPKGRFKYEPGQVRAFGMLAGGSGITPMFQVARAILENPKD
KTRVHLIYANVTHEDILLKDELDGLATTYPDRFQIFYVLNQPPEVWDGGVGFVSKEMIQT
HLPAPGPDIQILRCGPPPMNKAMAAHLESLEYAPHMQFQF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctatggatttcatcgagtcactcgatcctcagatcctcgtgggtgtatctgtt
gcttttgtggtcattgttgctgcagcttttctcttctcctccaagaagccgaaaggttgc
ttagatccccagaatttcaaggacttcaaacttgtcaagcgcacacaattgagccacaat
gtggcaaagttcaaatttgaacttctgacatcgacttcaattttaggtcttccaattgga
caacacataagttgtaggggcaaggatagccaaggtgaagaggttatcaaaccatatacc
ccaaccacattggattctgatgttggatactttgaactagtgataaagatgtatcctcaa
ggaagaatgtcacaccatttccgtgagatgcgtgttggagatcatcttgctgtcaaggga
cccaagggccgtttcaagtatgaacctggccaagttagagcttttgggatgcttgctgga
ggctctggaatcactccgatgttccaggttgctagggcaatattagaaaatcccaaagac
aaaacaagggttcacctgatctatgccaacgtgacacacgaggacattctcttaaaggat
gagttggatggccttgctactacctaccctgatcgctttcaaatcttctacgtattgaac
cagcctcctgaagtatgggatgggggagttggatttgtctcgaaggaaatgattcaaacc
catttgcccgcccctggccctgatatacagatcctaagatgtggtccaccacccatgaac
aaggccatggctgctcatcttgaatcacttgaatatgcccctcatatgcagttccagttc
tga

DBGET integrated database retrieval system