KEGG   Fragaria vesca (woodland strawberry): 101314651Help
Entry
101314651         CDS       T02666                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101314651
Peptidases [BR:fve01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101314651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 334 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDSLNSLRPVYGLIFLFKWRPGEKDD
RLVIKDPNPNLFFASQVINNACATQAILSILLNCPDVDIGPELSKLKEFTKNFPPELKGL
AINNSEAIRAAHNSFARPEPFVPEEQKAAGKDDDVYHFISYLPVDGVLYELDGLKEGPIS
LGQCPGGQGDMEWLQMVQPAIQERIERYSKSEIRFNLLAIIKNRKEMYTVELKELQKKRE
RILQQLSILQSERPDDGSKFQALNKALSEVNAGIEGATEKILIEEEKFKKWRTENIRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKAGNPR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgtacgattgagtccgaccccggggtctttaccgagcttattcagcagatg
caagtaaaaggtgtgcaggttgaggagctgtattcattggacattgattctctgaacagt
ttgagaccagtatatggtttgattttcctgttcaaatggcgtcctggggagaaggatgac
cgccttgtgattaaagatccaaatcctaacttgttttttgcgagtcaggttattaataat
gcctgtgcaacccaagcaatcttgtctatcctcctcaactgtccggatgttgacattggt
cctgaactgtcaaaactgaaagagtttacaaagaactttccacctgaactgaaaggattg
gccataaacaatagtgaagccattcgtgcagcccacaatagttttgcaaggcctgagcct
tttgttcctgaggagcaaaaggctgctggaaaagatgatgacgtctatcattttataagc
tacttgcctgttgatggggtcttgtatgagcttgacggactgaaggagggacccattagc
cttggacagtgccctggtgggcaaggtgacatggaatggctgcagatggtgcagcctgca
atccaggaacggattgaaaggtactccaaaagcgagataagattcaatctcctggccatt
attaagaacaggaaagagatgtatactgttgaacttaaggagctccaaaagaagagggag
cgcattttgcagcagctatctatcttacagtcggagagaccggatgatggtagcaaattc
caagcgctcaacaaagccctttcagaagtaaatgcggggattgagggtgctaccgagaag
atcttgattgaggaagagaagtttaagaagtggagaacagaaaacatccgcaggaaacac
aactatataccctttttgttcaacttcctcaagattttggctgagaagaagcagctgaag
cctctgattgagaaggcgaagcagaaggcaggcaaccctaggtga

DBGET integrated database retrieval system