KEGG   Fragaria vesca (woodland strawberry): 101315234Help
Entry
101315234         CDS       T02666                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101315234
   00500 Starch and sucrose metabolism
    101315234
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101315234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG5
AA seq 694 aa AA seqDB search
MADRRPLLPSDPDALPTAYAGSSSSPEIRRIHVKEVLAMFAGVVMVSLLVVIIGNTGHDQ
EAGNASHHRNYMPDKPMPLTSSSPTNETATIPDKLQAVSRGMAAGVSEKSSRLYSSGFGA
GTPVYPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPKGAVWGNIVWG
HAVSRDLIHWLHLPLAMVADQWYDINGVWTGSATILPNGQIVMLYTGSTNESVQVQCLAY
PADHNDPLLTKWIKYSGNPVLFPPPGIGIKDFRDPTTAWYTKEGKWRITIGSKVNKTGIS
LVYDTKDFIKYEQLDGVLHAVPGTGMWECIDFYPVSKTSDKGLDTSENGADVKHVIKTSL
DDDRNDYYALGSYNEQTGKWVPDNPNIDVGIGIRYDYGKFYASKTFYDQNKQRRVLWGWI
GESDSENADVQKGWASLQGIPRTVLFDQKTGSNLLQWPVEEIEKLRLNMNNFDRVQVKAG
SVVPLDVGTATQLDIVAEFELDQTVLESTAESNEEFSCQTSGGAGKRGALGPFGLLVLAD
DGLTERTPVYFYVVKGSGGTVNTYFCADQTRSTVANDVVKQVSGSYVPVLKGEKLSVRIL
VDHSIIDSFAQGGRTTITTRVYPTQAIYGAARLFLFNNATETSVTASLQVWQMNSAFIRP
FSPDAASHASFTPVTIFINFIVPFGLFLTLYFVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcagacagaaggcctttgcttccgtccgaccccgatgcccttcccacagcctacgcc
ggatcctcctcctctccggagatccggcggatacacgtgaaggaggtcctggcgatgttc
gccggggttgtgatggtttctttgttggtggtcattatagggaatactggtcatgatcag
gaggccgggaatgccagccaccaccggaactacatgcctgataagccaatgccattgact
tcgtcttcgccgaccaatgagactgcgaccataccagacaagttgcaggcggtgtcacgt
ggcatggcggccggagtgtcggagaagtcgagccggttgtacagcagcggcttcggggca
ggcacgccggtgtatccgtggaacaatagcatgttgtcgtggcagaggactgccttccat
tttcagccggagaagaattggatgaatgatcccaacggtccattattctacaagggttgg
taccattttttctaccagtacaatcccaaaggtgcagtttggggaaacatagtatggggt
catgcagtatccagagacttgatccattggcttcaccttcctctagcaatggtagctgat
caatggtatgacatcaatggagtctggactggctctgctacaattctccccaatggccaa
attgtcatgctctacactggttcaaccaacgagtccgtccaggtccaatgtcttgcatac
cctgctgaccacaatgaccctctcctcaccaagtggatcaagtactccggcaacccggtt
ctattcccccctcccgggatcggaatcaaggacttccgggacccgaccaccgcttggtac
accaaagaaggcaaatggaggatcacaatcgggtccaaggttaacaaaactggtatatct
ttagtttatgacaccaaggactttattaagtatgagcagcttgatggtgtgcttcatgct
gtgcctggtactggaatgtgggaatgcattgatttttatccggtgtcgaaaactagtgac
aaggggctggacacttctgagaatggtgctgatgtgaagcatgtgataaagactagcctt
gatgatgataggaatgattactatgcattggggagttataacgagcagactggaaaatgg
gttcctgataatccaaacattgatgttgggattgggattaggtatgattatgggaaattc
tatgcttccaagaccttctatgatcagaacaagcagagaagggtgttgtggggatggatt
ggagagtctgatagtgaaaatgctgatgtccagaagggttgggcatctcttcagggaatt
ccaagaacagtgttgtttgatcaaaagactggtagcaatctacttcaatggccagtggag
gagattgagaaattgagattgaatatgaacaacttcgacagagtacaagtcaaggcaggg
tcagtggtgccacttgacgttggcacagccacacagttggacatcgtcgcagagtttgag
ttggatcagacggttttagagagcacagctgaatctaacgaggaattcagttgccaaact
agtggtggagctggcaaacgcggcgcattgggaccctttggtcttcttgttcttgcggat
gacggcctcactgagcgcactcctgtctacttttatgttgtcaagggatctggtggcact
gtcaatacctacttctgtgctgatcaaacaaggtctactgtggcaaatgatgttgttaaa
caagttagtggtagctatgttccagtgctgaaaggtgaaaagctgtctgtgagaatactg
gttgatcattcgatcattgacagctttgctcaaggtggacgaacaacgataacaacgcgc
gtttacccaactcaagcaatttatggagctgcaaggcttttcttgttcaacaatgctact
gagaccagtgttactgcctcactccaggtatggcagatgaactctgccttcatacgccca
ttttcacctgatgcagcaagccatgcaagcttcacccctgtcacaatattcatcaatttc
atcgtcccattcggactatttttaactttatattttgtaagataa

DBGET integrated database retrieval system