KEGG   Fragaria vesca (woodland strawberry): 101315316Help
Entry
101315316         CDS       T02666                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101315316
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101315316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 246 aa AA seqDB search
MKSLHFPSPLSFSSLISNPSSHSNPKPMASFKPSIPSGEVHVIMGPMFAGKTTALLRRIK
SEGASGRNVVMIKSSKDNRYAVDSVVTHDGAKFPCWALPDLSSFRLKFGGDAYDKLDVIG
IDEAQFFEDLYDFCCTAADHDGKTVIVAGLDGDYLRRSFGSVLDVVPLADTVTKLTARCE
MCGKRAFFTLRKTEETKTELIGGADVYMPVCRQHYVNGQVLIKAARTVVESHKFKSGTIS
EVAPIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcccttcacttcccatctcctctttccttctcttccctaatttcaaacccctct
tctcactctaatcccaaacccatggcttccttcaaaccttccatcccctccggcgaggtc
cacgtcatcatgggtcccatgttcgccggcaagaccaccgctctcctccgccggatcaag
tccgagggcgccagcggcagaaatgtggtgatgataaaatcgagcaaggataatagatat
gctgttgattcggttgtgactcatgatggggccaagtttccgtgctgggctttgccggat
ctgtcctcgtttaggctcaaatttggaggagatgcttatgataagcttgatgttattggt
attgacgaggctcagtttttcgaagatctatatgatttctgctgcacggctgctgatcat
gatgggaagactgtgattgttgcaggcttggatggtgattacttgaggaggagctttggc
tcggtgcttgatgtagtgcctcttgctgatacagtgaccaagctgacagctcgatgtgaa
atgtgtggcaaacgagctttctttaccctgaggaagactgaggagacaaagactgaactg
attggtggggctgatgtctacatgcctgtttgtcgccaacactatgtcaacggacaagtt
cttatcaaagctgcaagaactgttgtggagtctcataaatttaagagtggcaccatttca
gaagtagctccaatcttttag

DBGET integrated database retrieval system