KEGG   Fusarium verticillioides: FVEG_08584Help
Entry
FVEG_08584        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00052  Galactose metabolism
fvr00500  Starch and sucrose metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FVEG_08584
   00500 Starch and sucrose metabolism
    FVEG_08584
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FVEG_08584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 BNR CHB_HEX_C
Motif
Other DBs
NCBI-GeneID: 30066305
NCBI-ProteinID: XP_018755136
UniProt: W7MN31
Position
10
AA seq 606 aa AA seqDB search
MTAIETCKVTTEAKTYLGTPKRSTMTVKNTTPRPRWHPSPTYHLKAPRGWINDPCAPGYD
PSTGTYHLSYQWNPKSCDWGDITWGHYTSRDGLTWKQNTQNPVLEPSEPYDDKGIFTGCL
HPTGLQGEEGQLTVIYSSITNLPIHWTLPYTRNCAGLSVATSTDGGKTWQKSEQNPILEG
EPKDLTVTGFRDPYLAEWPALDEMRGEASLYGFVSGGVVDGGPTVFLYAISPTDLTQWTY
LGPLIDLPTGYSPSGRWGGDFGVNWECVNFMTLHNESEERPFLLMGTEGGVKPGAKEGSD
QWSLWMAGSLEQTEQGPRIKPEYSGILDHGCLYAPNSYEHPITKNRIIWGWLKEDELTLA
RRESKGWTGYFSIPRELFLYTVENVTRTLTSSLADVGCIKATENGRGSNTVQTLGIRPLP
DLQGLRRGKPGYWNNIGTKGNLGKLVDTQTGSWELEATIKVSPNDQGLGFWIRHNEDLSE
GTAIHFSPQSEEITVDRSKSNHEADIEKDSVSGPFTLFYSDRNGSEELEKLHLRIFCDGD
VLEVFANDRFALSTMVYADTRDCTGLSWFVEGNGASETVFESMKLWENMKEVVEVDEPVV
YERSQL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatcgagacttgtaaagtgacgacggaggcgaaaacgtacttgggcaccccg
aaaagaagcacaatgacggtcaagaacactacaccccgccctcgatggcatccttccccg
acgtaccaccttaaagcacctcggggttggatcaatgatccgtgcgcacctggatatgac
ccctcaacaggcacataccacctatcctatcaatggaaccccaaatcctgcgattggggt
gacatcacttggggtcattacacaagcagagacggccttacttggaagcaaaacacacaa
aatccagttctagaaccctctgagccttacgatgacaagggcatcttcactggctgtctt
catcctactggccttcaaggagaagaaggacaactcactgttatctactcatccatcaca
aatcttcccattcactggactttaccgtatacccgaaactgcgctggattgtcagtagca
acatcgacagacggcggcaagacatggcagaagagcgaacaaaacccaatcttggagggt
gaacccaaagatctcaccgtcacagggttccgagacccatatctcgcagaatggcctgct
ttggatgaaatgagaggcgaggcgagcttgtacggtttcgtatctggaggtgttgtcgac
ggcggacctacagtgtttctctacgctatctcaccaaccgacttgacacaatggacatac
ctcggccctctgatcgatttacccacaggatatagcccctctggacgatggggcggcgac
ttcggtgtcaactgggagtgcgttaactttatgactcttcacaacgagtccgaggagcga
cctttcctacttatgggaaccgaaggtggagttaagcctggtgcgaaggagggtagcgat
cagtggtcgctttggatggctgggtctctcgagcagaccgagcaaggacctcggataaag
cccgagtacagcggaattctcgaccacggatgtttatacgcacctaactcttacgagcat
cctatcacaaagaacaggatcatttggggatggctgaaggaggacgagcttaccttggcc
cgacgcgaatccaagggttggaccggatacttctctatccctcgtgagctattcttatac
acggtcgaaaacgtaacgaggactctgacttcatcgctggccgatgttggttgcatcaaa
gctactgagaatgggcgagggtcaaacacagtccagacattgggaattcggcctctgcca
gatcttcagggacttcggaggggcaagcccggctactggaataacattggcaccaaaggc
aaccttgggaagcttgtagatacacaaaccgggagctgggagttggaagctaccatcaag
gtctcaccaaacgaccaaggacttggattctggatccgacacaacgaagacttgtctgaa
ggaacagccattcacttctccccccaaagcgaggaaatcaccgtcgaccgaagcaaatcc
aaccatgaagccgatatcgaaaaggactctgtttcaggacctttcacccttttctactct
gacagaaacggttcagaggagttggagaagctacacctgagaattttctgcgacggcgat
gttctcgaggtctttgccaacgatcgattcgctttatcgactatggtttatgcggatacg
agagattgcacgggtttgagctggtttgttgaaggaaatggagcaagcgagactgttttt
gaatcaatgaagctatgggagaacatgaaggaggtggttgaggttgatgagcctgttgtt
tatgagcgaagtcagttgtga

DBGET integrated database retrieval system