KEGG   Fusarium verticillioides: FVEG_12976Help
Entry
FVEG_12976        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00052  Galactose metabolism
fvr00500  Starch and sucrose metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FVEG_12976
   00500 Starch and sucrose metabolism
    FVEG_12976
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FVEG_12976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 30070369
NCBI-ProteinID: XP_018761065
UniProt: W7N5G1
Position
11
AA seq 655 aa AA seqDB search
MAALDSPILIQLPSKRHIYETAVYETQYNIPSTTTHNDVLQGQDPLATAKASEIQNEDAH
HRWRPRYHLMPPTGWLNDPCAPGYDHVHDVYHVGFQWNPKKPEWGDISWGSALSKDLVSW
EVSGSPSIQPSRKHDGEAGVFTGCWSPVPSAPGRSTAFYTSARRLPIHHTLPYNWGSEAI
CIATSNDAGRTWQRGNVPTVLSGPPPHLDATGWRDPYVAKWPALSRLLGDKSDQALFGIV
SGGLRGISPAIFIYSLEQHDLTAWNFLSVLTLAPTSPEEHHSQWEPDYGANWEVVNFLSL
LDPDDPAISHEVLMIGVEGRKQVDVKPSGRHRHSEFRRDHGEMWVSGPLMQTSAGMQMQF
RSGGALDYGAIYAVNSFHDPRSNHQVAFGWIIEEDLSAELRGAQRWAGLLSVPRVVQLSR
IHHVVHALKSDLASIKSFDVVPEDKAQQKSLFPKDSPQTYTITTVCALPDPRLNKLRQRK
RPMGPITNHTLPEALGSLEFPLRCSCWELDVSFEIGKDVQSIGFMISHTKDSQLRTVVSF
IPDLEKLIITRDKSTNMTDICVADEEAPHTLFSTLSPGTTAGAEPILSQEPLRLNAFFDV
SCLELFANGRTAITTRVYPESMTCYNIQPFVVRKSDRAWSGQLFECTAWELKPSC
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcagccctagattcacccatccttattcagctaccatccaaacgccacatctacgag
actgctgtttatgaaactcaatacaatataccctcgacgacaacccataacgatgtactt
caaggccaagatccccttgccaccgccaaagcatcggaaatccagaacgaagatgcccat
catcgctggagaccgcgttatcacctcatgccgccaactggctggctgaacgacccttgt
gcaccaggatatgatcacgtccatgatgtttatcacgttgggttccagtggaatcccaag
aagccagaatggggcgatatatcatggggcagcgctctctcaaaggacctcgtttcctgg
gaggtcagtggcagtccatctattcaaccatcgaggaagcatgatggagaagctggtgtt
ttcacagggtgttggagtccagtaccctcagcacctggtcggagcactgcattttatacc
tcagcgcggaggcttccgatacaccatacacttccctacaactggggttctgaagcaatt
tgcattgccacctccaacgacgccggtcgcacttggcaaaggggcaatgtaccgactgtt
ctgagtggccctcctccccatctcgatgctacaggctggcgtgacccttacgttgccaag
tggcctgctctcagccggctactaggagacaagtcagatcaagcactctttggcattgtt
tctggtggtcttcgcggcattagccctgcaatatttatttactctcttgaacaacacgat
ttaaccgcctggaacttcctctctgtgttgaccttagcaccgacctccccagaggaacat
cattcacaatgggagcccgactatggtgcaaactgggaagtggtcaacttcctttcgctc
ctcgaccctgatgacccagcgataagccatgaggtacttatgattggcgtcgaggggcgc
aagcaagttgacgtcaagccttctggacgacatcgccattcggaattcagaagggatcac
ggtgagatgtgggtttcaggccctttgatgcagacttcagcagggatgcagatgcaattt
cgttctggcggtgctctggactacggagcaatctatgctgtcaactccttccacgatccg
agatccaatcatcaagttgcatttggctggattattgaggaagatctctctgcagaactg
aggggcgcacaaagatgggctggactgttatcggtcccgagagtcgttcagttgagcagg
atacatcacgttgtccatgcattgaagtcagatctggcatcgatcaagtcatttgacgtt
gtgccagaggacaaagcgcagcagaagtcactgttcccaaaagactctcctcagacctac
acgattacgacagtgtgtgctttgccagaccctagactcaacaaacttcgccaacgcaag
cggcccatgggtcccataaccaatcacactctgcctgaggctcttggaagcttggaattt
cccctaaggtgctcctgctgggagctcgacgtatctttcgagattggcaaggacgtacag
agcattggtttcatgataagccatacgaaagattcacaactacgtaccgtcgtctcgttc
attcctgacttagaaaagctcataatcacacgagacaaatccaccaacatgacagacata
tgcgtggcggacgaagaggcaccgcatacccttttctcgaccttgtctcccggaactacc
gcaggagctgagccaattttgtcacaagagcctttacgactcaatgcattctttgatgtg
agttgtctagagcttttcgccaatggaaggacggcaatcactacaagagtctacccggaa
agcatgacctgctataacattcagccattcgtggtaaggaagagtgatcgcgcgtggtct
ggtcagttgtttgagtgtacggcgtgggagctaaagccgtcgtgttag

DBGET integrated database retrieval system