KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0222Help
Entry
Glaag_0222        CDS       T01483                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Glaag_0222
  Lipid metabolism
   00600 Sphingolipid metabolism
    Glaag_0222
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Glaag_0222
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Glaag_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247405..250530
Genome map
AA seq 1041 aa AA seqDB search
MTSSESSTVPDWQNPQVFAINKEPARASFYGFSHDPQKYVDTPFDSQDYFNLNGEWDFHW
VEAPHLRPKDFFKPDFDARHWNKIAVPGNWQLLGYGAANYINMAVDFASHPIAGEVPADN
NPVGSYRRDFVLPDNWTDKQVFIYLGAVKSAFYIWVNGHKVGYSQDSKTPAEFDITQYVN
AGNNVLALEVYRWSDGTYLELQDMWRLSGIERDVYLYCTPKVRVRDFHALGTLDSDYLHG
EFALSVSIQSHLTEQENSEQGCKVRASLLDADMAVVFEQVEPVIDLNGYSTELHFAGKIE
HVAKWSAETPYLYQLELTVVTAKQQAIQHIYSRVGFRSSELKNGNVLINGQPVLFKGVNR
HDHDPVTGHVISRESMRRDMQLLKQFNINAVRTSHYPNDPYWYALADEYGMYIVDEANIE
SHGIGAANQAIAYDPKGHMGNMPDWKGAYLDRVSNMYERDKNHPSVVIWSIGNETGDGPN
MEALYDWLKSKTSMPVMSEQAQLRRHTDMYSQMYAPIPVLEHYAQLGETRPLILCEYEHA
MGNSMGNLADYWQVIEKYPLLQGGFIWDWVDQTFALTTKDGTPYWGYGGDMETPGMYNDG
NFSANGVMAADRTPNPHAFEVQTVYQHMCVVAFDVEKQSIKVTNKRYFTDLSDVSLHWHI
EENGHVVQQGVIDTLNIPAQATADVSFPIQVDTLPEAEYFANFAFISKTSSDMVPAGFTV
ARSQILLEHLSCAVDLPQDTAEKIDQLQISESDSQLIYSGADFSIHFDLALGLISEYHLQ
NQAMLLDPIRPEFWRAPTDNDFGEGFPEKAKDWQYAGQNIELTKCSWAALKDSNEHICGL
EITTEHYLKDVQSRYLSRYTMDSDGSVTFDIWFYAAPHQFHSALPRIGSLVQMPTQFDQV
QWFGRGPHENYWDRKTSAFVGRYAMSVDELAFPYVRPQENGYRSDVRWVTFHDASGVGLT
FKGLNQVGFGAQRYDVHEYDQFEKRGLHPHELTKHERVFINIDYKQRGVAGTDSWGTAPL
FQYTLPWRDYHYGFVMQPSRG
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttctgaatcttcgactgtacctgattggcaaaatcctcaggtcttcgctatt
aacaaagagccagcgcgagcctcattttatggtttttctcatgatccacagaaatatgtg
gataccccgtttgattctcaagactattttaatctcaatggggaatgggactttcattgg
gtagaagccccgcatttgcgaccgaaagattttttcaagcctgattttgatgcccgccat
tggaataaaattgctgtgccgggtaactggcaattattgggctatggcgcggcgaactat
attaatatggcggtcgattttgctagccatccgattgctggtgaagtgccggcggacaac
aaccctgtggggtcatatcgccgcgattttgtcttgcctgataattggacggataaacaa
gtttttatctatctaggggcagttaagtcagcattttatatatgggtgaatggtcataaa
gttggctattcacaagactctaagacaccagctgagtttgatattactcaatacgtaaac
gcaggaaacaatgtgcttgcgctggaggtatatcgctggtcagacggtacttatcttgag
ctacaggatatgtggcgattgtctggaattgagcgcgatgtgtatttgtattgcacacct
aaagtgcgggtgcgagattttcatgcgctgggaacactagacagcgattacctgcatggt
gagtttgcactaagcgttagtattcagtctcatttgactgaacaagaaaatagcgagcaa
ggctgtaaagtgcgcgcgagtttactcgacgctgacatggccgttgtattcgagcaagta
gagcctgtaatagacttaaatgggtattctactgaattacattttgctggcaaaattgag
catgttgctaagtggagtgctgaaacgccttacttgtatcaacttgaactgacagtggta
actgctaagcagcaggcaattcagcacatatactcgcgcgtgggatttcgtagcagtgaa
ctgaaaaatggcaacgtgttaattaacggccagcccgtattattcaaaggggtaaaccgc
catgatcatgacccagtaacggggcatgtcatcagtcgggaatctatgcgccgagatatg
caattgctcaaacagtttaatatcaacgcagtgcgtacctcgcattatccaaatgaccct
tattggtacgcattggctgatgaatacggtatgtatattgtcgatgaagccaatattgaa
tctcatggtattggcgctgccaatcaagcgattgcttacgacccgaaaggacatatgggt
aatatgcctgactggaaaggcgcctacttagatcgtgtttctaacatgtatgaacgagat
aaaaaccaccccagcgtcgtgatatggtcaattggcaatgagacgggcgacgggccgaat
atggaggctttgtacgactggctgaaaagtaaaaccagtatgccagtcatgtcagagcaa
gctcagttgcgccgccatactgatatgtatagtcagatgtatgcgcctatccctgtgctt
gagcactatgctcaacttggtgaaacccgcccgctcattttatgcgaatacgaacacgcc
atgggcaattccatggggaatcttgctgattattggcaagtgatcgagaaatatccgctt
ctgcaaggtggttttatttgggactgggtggatcaaacctttgcattgaccacaaaagac
ggcacgccatattggggctacggcggagatatggaaacgccgggtatgtataacgatggt
aatttcagtgccaatggcgtaatggcggcggatagaacgcccaatcctcacgcattcgaa
gtacagacggtttatcagcatatgtgtgttgttgcgtttgatgttgaaaagcagtctatt
aaggtgacgaacaaacgatactttactgatttatccgatgtgtcactgcattggcatatc
gaagaaaatggtcatgtcgttcagcaaggggttattgataccttgaacattccggcgcaa
gcaacggcagatgttagctttcctatacaggtagatacattgcctgaggctgagtatttc
gccaactttgcctttattagcaaaactagctctgacatggtgcccgcaggttttactgtt
gctcgcagtcagatactccttgagcacttatcttgtgctgtagatttaccgcaagatacc
gctgaaaaaatagaccagttgcaaataagtgagtcggattcacaactgatatatagcggg
gctgatttttctatccattttgatttggcattgggtttaattagcgagtatcacttacaa
aaccaagcaatgctgcttgaccctattcgcccagagttttggcgtgctcctactgataat
gatttcggggaaggctttcctgaaaaagccaaagattggcagtatgccgggcagaatatt
gagctgaccaagtgtagctgggcggcactcaaagatagcaatgagcatatttgtgggctt
gaaataacaacagagcattacctgaaggacgtgcaaagccgatatttgagtcgctataca
atggatagcgatggcagcgttacctttgatatatggttttatgcagcacctcatcaattt
cacagtgccttgccacgtattggtagtctcgtgcaaatgcctactcagtttgatcaggtt
caatggtttggccgcggcccccacgaaaactattgggatcgaaaaacgtcggcatttgtt
gggcgttatgcaatgtcagtagatgaattggcgtttccttacgttcgccctcaagaaaat
ggctatcgtagcgatgtgcgttgggtgactttccatgatgcaagtggagtgggattgacc
ttcaaaggattaaaccaagtcggctttggcgcccagcgttatgacgtacacgaatacgac
cagtttgaaaaacgcggcttacatccgcatgaattaaccaaacatgagcgggtgtttatc
aatattgattacaagcagcgtggcgtagcaggaacagattcttggggcacagctcctttg
tttcagtacaccttaccttggcgggattatcattatggatttgtgatgcagccaagccgt
gggtaa

DBGET integrated database retrieval system